KEGG   Homo sapiens (human): 6745Help
Entry
6745              CDS       T01001                                 

Gene name
SSR1, TRAPA
Definition
(RefSeq) signal sequence receptor subunit 1
  KO
K13249  
translocon-associated protein subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
Translocon-associated protein (TRAP) complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6745 (SSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p24.3
AA seq 286 aa AA seqDB search
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDE
PTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESL
DASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDL
NGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQK
VEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagactcctcccccgcttgctgctgcttctcttactcgtgttccctgccactgtcttg
ttccgaggcggccccagaggcttgttagcagtggcacaagatcttacagaggatgaagaa
acagtagaagattccataattgaggatgaagatgatgaagccgaggtagaagaagatgaa
cccacagatttggtagaagataaagaggaagaagatgtgtctggtgaacctgaagcttca
ccgagtgcagatacaactatactgtttgtaaaaggagaagattttccagcaaataacatt
gtgaagttcctggtaggctttaccaacaagggtacagaagattttattgttgaatcctta
gatgcctcattccgttatcctcaggactaccagttttatatccagaatttcacagctctt
cctctgaacactgtagtgccaccccagagacaggcaacttttgagtactctttcattcct
gcagagcccatgggcggacgaccatttggtttggtcatcaatctgaactacaaagatttg
aacggcaatgtattccaagatgcagtcttcaatcaaacagttacagttattgaaagagag
gatgggttagatggagaaacaatctttatgtatatgttccttgctggtcttgggcttctg
gttattgttggccttcatcaactcctagaatctagaaagcgtaagagacccatacagaaa
gtagaaatgggtacatcaagtcagaatgatgttgacatgagttggattcctcaggaaaca
ttgaatcaaatcaataaagcttcaccaagaaggttgcccaggaaacgggcacagaagaga
tcagtgggatctgatgagtaa

DBGET integrated database retrieval system