KEGG   Homo sapiens (human): 675Help
Entry
675               CDS       T01001                                 

Gene name
BRCA2, BRCC2, BROVCA2, FACD, FAD, FAD1, FANCD, FANCD1, GLM3, PNCA2
Definition
breast cancer 2, early onset
Orthology
K08775  
breast cancer 2 susceptibility protein
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Fanconi anemia pathway
Pathways in cancer
Pancreatic cancer
Disease
H00019  
Pancreatic cancer
H00027  
Ovarian cancer
H00031  
Breast cancer
H00238  
Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    675 (BRCA2)
   03460 Fanconi anemia pathway
    675 (BRCA2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    675 (BRCA2)
   05212 Pancreatic cancer
    675 (BRCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.3
AA seq 3418 aa AA seqDB search
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPN
LFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTV
KTKMDQADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHI
SESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESL
KKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV
DTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEP
NDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDC
ILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGL
EIHTVCSQKEDSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSY
KGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLT
SSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCEND
PKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLS
NLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVK
QHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLS
EHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSD
CKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKS
TFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDC
NKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL
SSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENE
DNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQI
KEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAK
ESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTG
NQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFS
HQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNL
CRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTS
VSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYL
SNSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAY
PQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIK
KVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKV
FADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSANTCGIFST
ASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLI
SQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQ
NVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQ
DKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSE
NYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILV
GEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKE
RQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTG
RPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQFNKN
NSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPR
ISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQ
LADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPK
EFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANI
SETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVG
SPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDV
IIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHEENT
TKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKK
QAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLL
TEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKF
LDPDFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLI
AASNLQWRPESKSGLLTLFAGDFSVFSASPKEGHFQETFNKMKNTVENIDILCNEAENKL
MHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSLCMAKRKSV
STPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQP
PRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEK
QFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI
NT seq 10257 nt NT seq  +upstreamnt  +downstreamnt
atgcctattggatccaaagagaggccaacattttttgaaatttttaagacacgctgcaac
aaagcagatttaggaccaataagtcttaattggtttgaagaactttcttcagaagctcca
ccctataattctgaacctgcagaagaatctgaacataaaaacaacaattacgaaccaaac
ctatttaaaactccacaaaggaaaccatcttataatcagctggcttcaactccaataata
ttcaaagagcaagggctgactctgccgctgtaccaatctcctgtaaaagaattagataaa
ttcaaattagacttaggaaggaatgttcccaatagtagacataaaagtcttcgcacagtg
aaaactaaaatggatcaagcagatgatgtttcctgtccacttctaaattcttgtcttagt
gaaagtcctgttgttctacaatgtacacatgtaacaccacaaagagataagtcagtggta
tgtgggagtttgtttcatacaccaaagtttgtgaagggtcgtcagacaccaaaacatatt
tctgaaagtctaggagctgaggtggatcctgatatgtcttggtcaagttctttagctaca
ccacccacccttagttctactgtgctcatagtcagaaatgaagaagcatctgaaactgta
tttcctcatgatactactgctaatgtgaaaagctatttttccaatcatgatgaaagtctg
aagaaaaatgatagatttatcgcttctgtgacagacagtgaaaacacaaatcaaagagaa
gctgcaagtcatggatttggaaaaacatcagggaattcatttaaagtaaatagctgcaaa
gaccacattggaaagtcaatgccaaatgtcctagaagatgaagtatatgaaacagttgta
gatacctctgaagaagatagtttttcattatgtttttctaaatgtagaacaaaaaatcta
caaaaagtaagaactagcaagactaggaaaaaaattttccatgaagcaaacgctgatgaa
tgtgaaaaatctaaaaaccaagtgaaagaaaaatactcatttgtatctgaagtggaacca
aatgatactgatccattagattcaaatgtagcaaatcagaagccctttgagagtggaagt
gacaaaatctccaaggaagttgtaccgtctttggcctgtgaatggtctcaactaaccctt
tcaggtctaaatggagcccagatggagaaaatacccctattgcatatttcttcatgtgac
caaaatatttcagaaaaagacctattagacacagagaacaaaagaaagaaagattttctt
acttcagagaattctttgccacgtatttctagcctaccaaaatcagagaagccattaaat
gaggaaacagtggtaaataagagagatgaagagcagcatcttgaatctcatacagactgc
attcttgcagtaaagcaggcaatatctggaacttctccagtggcttcttcatttcagggt
atcaaaaagtctatattcagaataagagaatcacctaaagagactttcaatgcaagtttt
tcaggtcatatgactgatccaaactttaaaaaagaaactgaagcctctgaaagtggactg
gaaatacatactgtttgctcacagaaggaggactccttatgtccaaatttaattgataat
ggaagctggccagccaccaccacacagaattctgtagctttgaagaatgcaggtttaata
tccactttgaaaaagaaaacaaataagtttatttatgctatacatgatgaaacatcttat
aaaggaaaaaaaataccgaaagaccaaaaatcagaactaattaactgttcagcccagttt
gaagcaaatgcttttgaagcaccacttacatttgcaaatgctgattcaggtttattgcat
tcttctgtgaaaagaagctgttcacagaatgattctgaagaaccaactttgtccttaact
agctcttttgggacaattctgaggaaatgttctagaaatgaaacatgttctaataataca
gtaatctctcaggatcttgattataaagaagcaaaatgtaataaggaaaaactacagtta
tttattaccccagaagctgattctctgtcatgcctgcaggaaggacagtgtgaaaatgat
ccaaaaagcaaaaaagtttcagatataaaagaagaggtcttggctgcagcatgtcaccca
gtacaacattcaaaagtggaatacagtgatactgactttcaatcccagaaaagtctttta
tatgatcatgaaaatgccagcactcttattttaactcctacttccaaggatgttctgtca
aacctagtcatgatttctagaggcaaagaatcatacaaaatgtcagacaagctcaaaggt
aacaattatgaatctgatgttgaattaaccaaaaatattcccatggaaaagaatcaagat
gtatgtgctttaaatgaaaattataaaaacgttgagctgttgccacctgaaaaatacatg
agagtagcatcaccttcaagaaaggtacaattcaaccaaaacacaaatctaagagtaatc
caaaaaaatcaagaagaaactacttcaatttcaaaaataactgtcaatccagactctgaa
gaacttttctcagacaatgagaataattttgtcttccaagtagctaatgaaaggaataat
cttgctttaggaaatactaaggaacttcatgaaacagacttgacttgtgtaaacgaaccc
attttcaagaactctaccatggttttatatggagacacaggtgataaacaagcaacccaa
gtgtcaattaaaaaagatttggtttatgttcttgcagaggagaacaaaaatagtgtaaag
cagcatataaaaatgactctaggtcaagatttaaaatcggacatctccttgaatatagat
aaaataccagaaaaaaataatgattacatgaacaaatgggcaggactcttaggtccaatt
tcaaatcacagttttggaggtagcttcagaacagcttcaaataaggaaatcaagctctct
gaacataacattaagaagagcaaaatgttcttcaaagatattgaagaacaatatcctact
agtttagcttgtgttgaaattgtaaataccttggcattagataatcaaaagaaactgagc
aagcctcagtcaattaatactgtatctgcacatttacagagtagtgtagttgtttctgat
tgtaaaaatagtcatataacccctcagatgttattttccaagcaggattttaattcaaac
cataatttaacacctagccaaaaggcagaaattacagaactttctactatattagaagaa
tcaggaagtcagtttgaatttactcagtttagaaaaccaagctacatattgcagaagagt
acatttgaagtgcctgaaaaccagatgactatcttaaagaccacttctgaggaatgcaga
gatgctgatcttcatgtcataatgaatgccccatcgattggtcaggtagacagcagcaag
caatttgaaggtacagttgaaattaaacggaagtttgctggcctgttgaaaaatgactgt
aacaaaagtgcttctggttatttaacagatgaaaatgaagtggggtttaggggcttttat
tctgctcatggcacaaaactgaatgtttctactgaagctctgcaaaaagctgtgaaactg
tttagtgatattgagaatattagtgaggaaacttctgcagaggtacatccaataagttta
tcttcaagtaaatgtcatgattctgttgtttcaatgtttaagatagaaaatcataatgat
aaaactgtaagtgaaaaaaataataaatgccaactgatattacaaaataatattgaaatg
actactggcacttttgttgaagaaattactgaaaattacaagagaaatactgaaaatgaa
gataacaaatatactgctgccagtagaaattctcataacttagaatttgatggcagtgat
tcaagtaaaaatgatactgtttgtattcataaagatgaaacggacttgctatttactgat
cagcacaacatatgtcttaaattatctggccagtttatgaaggagggaaacactcagatt
aaagaagatttgtcagatttaacttttttggaagttgcgaaagctcaagaagcatgtcat
ggtaatacttcaaataaagaacagttaactgctactaaaacggagcaaaatataaaagat
tttgagacttctgatacattttttcagactgcaagtgggaaaaatattagtgtcgccaaa
gagtcatttaataaaattgtaaatttctttgatcagaaaccagaagaattgcataacttt
tccttaaattctgaattacattctgacataagaaagaacaaaatggacattctaagttat
gaggaaacagacatagttaaacacaaaatactgaaagaaagtgtcccagttggtactgga
aatcaactagtgaccttccagggacaacccgaacgtgatgaaaagatcaaagaacctact
ctattgggttttcatacagctagcgggaaaaaagttaaaattgcaaaggaatctttggac
aaagtgaaaaacctttttgatgaaaaagagcaaggtactagtgaaatcaccagttttagc
catcaatgggcaaagaccctaaagtacagagaggcctgtaaagaccttgaattagcatgt
gagaccattgagatcacagctgccccaaagtgtaaagaaatgcagaattctctcaataat
gataaaaaccttgtttctattgagactgtggtgccacctaagctcttaagtgataattta
tgtagacaaactgaaaatctcaaaacatcaaaaagtatctttttgaaagttaaagtacat
gaaaatgtagaaaaagaaacagcaaaaagtcctgcaacttgttacacaaatcagtcccct
tattcagtcattgaaaattcagccttagctttttacacaagttgtagtagaaaaacttct
gtgagtcagacttcattacttgaagcaaaaaaatggcttagagaaggaatatttgatggt
caaccagaaagaataaatactgcagattatgtaggaaattatttgtatgaaaataattca
aacagtactatagctgaaaatgacaaaaatcatctctccgaaaaacaagatacttattta
agtaacagtagcatgtctaacagctattcctaccattctgatgaggtatataatgattca
ggatatctctcaaaaaataaacttgattctggtattgagccagtattgaagaatgttgaa
gatcaaaaaaacactagtttttccaaagtaatatccaatgtaaaagatgcaaatgcatac
ccacaaactgtaaatgaagatatttgcgttgaggaacttgtgactagctcttcaccctgc
aaaaataaaaatgcagccattaaattgtccatatctaatagtaataattttgaggtaggg
ccacctgcatttaggatagccagtggtaaaatcgtttgtgtttcacatgaaacaattaaa
aaagtgaaagacatatttacagacagtttcagtaaagtaattaaggaaaacaacgagaat
aaatcaaaaatttgccaaacgaaaattatggcaggttgttacgaggcattggatgattca
gaggatattcttcataactctctagataatgatgaatgtagcacgcattcacataaggtt
tttgctgacattcagagtgaagaaattttacaacataaccaaaatatgtctggattggag
aaagtttctaaaatatcaccttgtgatgttagtttggaaacttcagatatatgtaaatgt
agtatagggaagcttcataagtcagtctcatctgcaaatacttgtgggatttttagcaca
gcaagtggaaaatctgtccaggtatcagatgcttcattacaaaacgcaagacaagtgttt
tctgaaatagaagatagtaccaagcaagtcttttccaaagtattgtttaaaagtaacgaa
cattcagaccagctcacaagagaagaaaatactgctatacgtactccagaacatttaata
tcccaaaaaggcttttcatataatgtggtaaattcatctgctttctctggatttagtaca
gcaagtggaaagcaagtttccattttagaaagttccttacacaaagttaagggagtgtta
gaggaatttgatttaatcagaactgagcatagtcttcactattcacctacgtctagacaa
aatgtatcaaaaatacttcctcgtgttgataagagaaacccagagcactgtgtaaactca
gaaatggaaaaaacctgcagtaaagaatttaaattatcaaataacttaaatgttgaaggt
ggttcttcagaaaataatcactctattaaagtttctccatatctctctcaatttcaacaa
gacaaacaacagttggtattaggaaccaaagtgtcacttgttgagaacattcatgttttg
ggaaaagaacaggcttcacctaaaaacgtaaaaatggaaattggtaaaactgaaactttt
tctgatgttcctgtgaaaacaaatatagaagtttgttctacttactccaaagattcagaa
aactactttgaaacagaagcagtagaaattgctaaagcttttatggaagatgatgaactg
acagattctaaactgccaagtcatgccacacattctctttttacatgtcccgaaaatgag
gaaatggttttgtcaaattcaagaattggaaaaagaagaggagagccccttatcttagtg
ggagaaccctcaatcaaaagaaacttattaaatgaatttgacaggataatagaaaatcaa
gaaaaatccttaaaggcttcaaaaagcactccagatggcacaataaaagatcgaagattg
tttatgcatcatgtttctttagagccgattacctgtgtaccctttcgcacaactaaggaa
cgtcaagagatacagaatccaaattttaccgcacctggtcaagaatttctgtctaaatct
catttgtatgaacatctgactttggaaaaatcttcaagcaatttagcagtttcaggacat
ccattttatcaagtttctgctacaagaaatgaaaaaatgagacacttgattactacaggc
agaccaaccaaagtctttgttccaccttttaaaactaaatcacattttcacagagttgaa
cagtgtgttaggaatattaacttggaggaaaacagacaaaagcaaaacattgatggacat
ggctctgatgatagtaaaaataagattaatgacaatgagattcatcagtttaacaaaaac
aactccaatcaagcagcagctgtaactttcacaaagtgtgaagaagaacctttagattta
attacaagtcttcagaatgccagagatatacaggatatgcgaattaagaagaaacaaagg
caacgcgtctttccacagccaggcagtctgtatcttgcaaaaacatccactctgcctcga
atctctctgaaagcagcagtaggaggccaagttccctctgcgtgttctcataaacagctg
tatacgtatggcgtttctaaacattgcataaaaattaacagcaaaaatgcagagtctttt
cagtttcacactgaagattattttggtaaggaaagtttatggactggaaaaggaatacag
ttggctgatggtggatggctcataccctccaatgatggaaaggctggaaaagaagaattt
tatagggctctgtgtgacactccaggtgtggatccaaagcttatttctagaatttgggtt
tataatcactatagatggatcatatggaaactggcagctatggaatgtgcctttcctaag
gaatttgctaatagatgcctaagcccagaaagggtgcttcttcaactaaaatacagatat
gatacggaaattgatagaagcagaagatcggctataaaaaagataatggaaagggatgac
acagctgcaaaaacacttgttctctgtgtttctgacataatttcattgagcgcaaatata
tctgaaacttctagcaataaaactagtagtgcagatacccaaaaagtggccattattgaa
cttacagatgggtggtatgctgttaaggcccagttagatcctcccctcttagctgtctta
aagaatggcagactgacagttggtcagaagattattcttcatggagcagaactggtgggc
tctcctgatgcctgtacacctcttgaagccccagaatctcttatgttaaagatttctgct
aacagtactcggcctgctcgctggtataccaaacttggattctttcctgaccctagacct
tttcctctgcccttatcatcgcttttcagtgatggaggaaatgttggttgtgttgatgta
attattcaaagagcataccctatacagtggatggagaagacatcatctggattatacata
tttcgcaatgaaagagaggaagaaaaggaagcagcaaaatatgtggaggcccaacaaaag
agactagaagccttattcactaaaattcaggaggaatttgaagaacatgaagaaaacaca
acaaaaccatatttaccatcacgtgcactaacaagacagcaagttcgtgctttgcaagat
ggtgcagagctttatgaagcagtgaagaatgcagcagacccagcttaccttgagggttat
ttcagtgaagagcagttaagagccttgaataatcacaggcaaatgttgaatgataagaaa
caagctcagatccagttggaaattaggaaggccatggaatctgctgaacaaaaggaacaa
ggtttatcaagggatgtcacaaccgtgtggaagttgcgtattgtaagctattcaaaaaaa
gaaaaagattcagttatactgagtatttggcgtccatcatcagatttatattctctgtta
acagaaggaaagagatacagaatttatcatcttgcaacttcaaaatctaaaagtaaatct
gaaagagctaacatacagttagcagcgacaaaaaaaactcagtatcaacaactaccggtt
tcagatgaaattttatttcagatttaccagccacgggagccccttcacttcagcaaattt
ttagatccagactttcagccatcttgttctgaggtggacctaataggatttgtcgtttct
gttgtgaaaaaaacaggacttgcccctttcgtctatttgtcagacgaatgttacaattta
ctggcaataaagttttggatagaccttaatgaggacattattaagcctcatatgttaatt
gctgcaagcaacctccagtggcgaccagaatccaaatcaggccttcttactttatttgct
ggagatttttctgtgttttctgctagtccaaaagagggccactttcaagagacattcaac
aaaatgaaaaatactgttgagaatattgacatactttgcaatgaagcagaaaacaagctt
atgcatatactgcatgcaaatgatcccaagtggtccaccccaactaaagactgtacttca
gggccgtacactgctcaaatcattcctggtacaggaaacaagcttctgatgtcttctcct
aattgtgagatatattatcaaagtcctttatcactttgtatggccaaaaggaagtctgtt
tccacacctgtctcagcccagatgacttcaaagtcttgtaaaggggagaaagagattgat
gaccaaaagaactgcaaaaagagaagagccttggatttcttgagtagactgcctttacct
ccacctgttagtcccatttgtacatttgtttctccggctgcacagaaggcatttcagcca
ccaaggagttgtggcaccaaatacgaaacacccataaagaaaaaagaactgaattctcct
cagatgactccatttaaaaaattcaatgaaatttctcttttggaaagtaattcaatagct
gacgaagaacttgcattgataaatacccaagctcttttgtctggttcaacaggagaaaaa
caatttatatctgtcagtgaatccactaggactgctcccaccagttcagaagattatctc
agactgaaacgacgttgtactacatctctgatcaaagaacaggagagttcccaggccagt
acggaagaatgtgagaaaaataagcaggacacaattacaactaaaaaatatatctaa

DBGET integrated database retrieval system