KEGG   Homo sapiens (human): 6751Help
Entry
6751              CDS       T01001                                 

Gene name
SSTR1, SRIF-2, SS-1-R, SS1-R, SS1R
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  
somatostatin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Indium (111In) pentetreotide: 
Lanreotide: 
Octreotide (DG00501): 
Somatostatin: 
Vapreotide (DG00502): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    6751 (SSTR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6751 (SSTR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    6751 (SSTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q13
AA seq 391 aa AA seqDB search
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctccttcctcctctcctagccccagcccgggcagc
tgcggcgaaggcggcggcagcaggggccccggggccggcgctgcggacggcatggaggag
ccagggcgaaatgcgtcccagaacgggaccttgagcgagggccagggcagcgccatcctg
atctctttcatctactccgtggtgtgcctggtggggctgtgtgggaactctatggtcatc
tacgtgatcctgcgctatgccaagatgaagacggccaccaacatctacatcctaaatctg
gccattgctgatgagctgctcatgctcagcgtgcccttcctagtcacctccacgttgttg
cgccactggcccttcggtgcgctgctctgccgcctcgtgctcagcgtggacgcggtcaac
atgttcaccagcatctactgtctgactgtgctcagcgtggaccgctacgtggccgtggtg
catcccatcaaggcggcccgctaccgccggcccaccgtggccaaggtagtaaacctgggc
gtgtgggtgctatcgctgctcgtcatcctgcccatcgtggtcttctctcgcaccgcggcc
aacagcgacggcacggtggcttgcaacatgctcatgccagagcccgctcaacgctggctg
gtgggcttcgtgttgtacacatttctcatgggcttcctgctgcccgtgggggctatctgc
ctgtgctacgtgctcatcattgctaagatgcgcatggtggccctcaaggccggctggcag
cagcgcaagcgctcggagcgcaagatcaccttaatggtgatgatggtggtgatggtgttt
gtcatctgctggatgcctttctacgtggtgcagctggtcaacgtgtttgctgagcaggac
gacgccacggtgagtcagctgtcggtcatcctcggctatgccaacagctgcgccaacccc
atcctctatggctttctctcagacaacttcaagcgctctttccaacgcatcctatgcctc
agctggatggacaacgccgcggaggagccggttgactattacgccaccgcgctcaagagc
cgtgcctacagtgtggaagacttccaacctgagaacctggagtccggcggcgtcttccgt
aatggcacctgcacgtcccggatcacgacgctctga

DBGET integrated database retrieval system