KEGG   Homo sapiens (human): 6752Help
Entry
6752              CDS       T01001                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor 2
  KO
K04218  
somatostatin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Drug target
Somatostatin: 
Octreotide [DG:DG00501]: 
Lanreotide: 
Vapreotide [DG:DG00502]: 
Indium (111In) pentetreotide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    6752 (SSTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6752 (SSTR2)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    6752 (SSTR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    6752 (SSTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24
AA seq 369 aa AA seqDB search
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcggatgagccactcaatggaagccacacatggctatccattccatttgac
ctcaatggctctgtggtgtcaaccaacacctcaaaccagacagagccgtactatgacctg
acaagcaatgcagtcctcacattcatctattttgtggtctgcatcattgggttgtgtggc
aacacacttgtcatttatgtcatcctccgctatgccaagatgaagaccatcaccaacatt
tacatcctcaacctggccatcgcagatgagctcttcatgctgggtctgcctttcttggct
atgcaggtggctctggtccactggccctttggcaaggccatttgccgggtggtcatgact
gtggatggcatcaatcagttcaccagcatcttctgcctgacagtcatgagcatcgaccga
tacctggctgtggtccaccccatcaagtcggccaagtggaggagaccccggacggccaag
atgatcaccatggctgtgtggggagtctctctgctggtcatcttgcccatcatgatatat
gctgggctccggagcaaccagtgggggagaagcagctgcaccatcaactggccaggtgaa
tctggggcttggtacacagggttcatcatctacactttcattctggggttcctggtaccc
ctcaccatcatctgtctttgctacctgttcattatcatcaaggtgaagtcctctggaatc
cgagtgggctcctctaagaggaagaagtctgagaagaaggtcacccgaatggtgtccatc
gtggtggctgtcttcatcttctgctggcttcccttctacatattcaacgtttcttccgtc
tccatggccatcagccccaccccagcccttaaaggcatgtttgactttgtggtggtcctc
acctatgctaacagctgtgccaaccctatcctatatgccttcttgtctgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggagcgg
agtgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagacctccaaaccagtatctga

DBGET integrated database retrieval system