KEGG   Homo sapiens (human): 6753Help
Entry
6753              CDS       T01001                                 

Gene name
SSTR3, SS-3-R, SS3-R, SS3R, SSR-28
Definition
somatostatin receptor 3
Orthology
K04219  
somatostatin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Somatostatin: 
Octreotide: 
Lanreotide: 
Vapreotide: 
Indium (111In) pentetreotide: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 418 aa AA seqDB search
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcttcatccatcatcggtgtccacgacctcagaacctgagaatgcctcctcg
gcctggcccccagatgccaccctgggcaacgtgtcggcgggcccaagcccggcagggctg
gccgtcagtggcgttctgatccccctggtctacctggtggtgtgcgtggtgggcctgctg
ggtaactcgctggtcatctatgtggtcctgcggcacacggccagcccttcagtcaccaac
gtctacatcctcaacctggcgctggccgacgagctcttcatgctggggctgcccttcctg
gccgcccagaacgccctgtcctactggcccttcggctccctcatgtgccgcctggtcatg
gcggtggatggcatcaaccagttcaccagcatattctgcctgactgtcatgagcgtggac
cgctacctggccgtggtacatcccacccgctcggcccgctggcgcacagctccggtggcc
cgcacggtcagcgcggctgtgtgggtggcctcagccgtggtggtgctgcccgtggtggtc
ttctcgggagtgccccgcggcatgagcacctgccacatgcagtggcccgagccggcggcg
gcctggcgagccggcttcatcatctacacggccgcactgggcttcttcgggccgctgctg
gtcatctgcctctgctacctgctcatcgtggtgaaggtgcgctcagctgggcgccgggtg
tgggcaccctcgtgccagcggcggcggcgctccgaacgcagggtcacgcgcatggtggtg
gccgtggtggcgctcttcgtgctctgctggatgcccttctacgtgctcaacatcgtcaac
gtggtgtgcccactgcccgaggagcctgccttctttgggctctacttcctggtggtggcg
ctgccctatgccaacagctgtgccaaccccatcctttatggcttcctctcctaccgcttc
aagcagggcttccgcagggtcctgctgcggccctcccgccgtgtgcgcagccaggagccc
actgtggggcccccggagaagactgaggaggaggatgaggaggaggaggatggggaggag
agcagggaggggggcaaggggaaggagatgaacggccgggtcagccagatcacgcagcct
ggcaccagcgggcaggagcggccgcccagcagagtggccagcaaggagcagcagctccta
ccccaagaggcttccactggggagaagtccagcacgatgcgcatcagctacctgtag

DBGET integrated database retrieval system