KEGG   Homo sapiens (human): 6754Help
Entry
6754              CDS       T01001                                 

Gene name
SSTR4, SS-4-R, SS4-R, SS4R
Definition
(RefSeq) somatostatin receptor 4
  KO
K04220  
somatostatin receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Indium (111In) pentetreotide: 
Lanreotide: 
Octreotide (DG00501): 
Somatostatin: 
Vapreotide (DG00502): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6754 (SSTR4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    6754 (SSTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.2
AA seq 388 aa AA seqDB search
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccctcgacgctgccccccgggggcgaggaagggctggggacggcctggccc
tctgcagccaatgccagtagcgctccggcggaggcggaggaggcggtggcggggcccggg
gacgcgcgggcggcgggcatggtcgctatccagtgcatctacgcgctggtgtgcctggtg
gggctggtgggcaacgccctggtcatcttcgtgatccttcgctacgccaagatgaagacg
gctaccaacatctacctgctcaacctggccgtagccgacgagctcttcatgctgagcgtg
cccttcgtggcctcgtcggccgccctgcgccactggcccttcggctccgtgctgtgccgc
gcggtgctcagcgtcgacggcctcaacatgttcaccagcgtcttctgtctcaccgtgctc
agcgtggaccgctacgtggccgtggtgcaccctctgcgcgcggcgacctaccggcggccc
agcgtggccaagctcatcaacctgggcgtgtggctggcatccctgttggtcactctcccc
atcgccatcttcgcagacaccagaccggctcgcggcggccaggccgtggcctgcaacctg
cagtggccacacccggcctggtcggcagtcttcgtggtctacactttcctgctgggcttc
ctgctgcccgtgctggccattggcctgtgctacctgctcatcgtgggcaagatgcgcgcc
gtggccctgcgcgctggctggcagcagcgcaggcgctcggagaagaaaatcaccaggctg
gtgctgatggtcgtggtcgtctttgtgctctgctggatgcctttctacgtggtgcagctg
ctgaacctcttcgtgaccagccttgatgccaccgtcaaccacgtgtcccttatccttagc
tatgccaacagctgcgccaaccccattctctatggcttcctctccgacaacttccgccga
ttcttccagcgggttctctgcctgcgctgctgcctcctggaaggtgctggaggtgctgag
gaggagcccctggactactatgccactgctctcaagagcaaaggtggggcagggtgcatg
tgccccccactcccctgccagcaggaagccctgcaaccagaacccggccgcaagcgcatc
cccctcaccaggaccaccaccttctga

DBGET integrated database retrieval system