KEGG   Homo sapiens (human): 6755Help
Entry
6755              CDS       T01001                                 

Gene name
SSTR5, SS-5-R
Definition
(RefSeq) somatostatin receptor 5
  KO
K04221  
somatostatin receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Indium (111In) pentetreotide: 
Lanreotide: 
Octreotide (DG00501): 
Pasireotide (DG00503): 
Somatostatin: 
Vapreotide (DG00502): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    6755 (SSTR5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6755 (SSTR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    6755 (SSTR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 364 aa AA seqDB search
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggagcccctgttcccagcctccacgcccagctggaacgcctcctccccgggggctgcc
tctggaggcggtgacaacaggacgctggtggggccggcgccctcggcaggggcccgggcg
gtgctggtgcccgtgctgtacctgctggtgtgtgcggccgggctgggcgggaacacgctg
gtcatctacgtggtgctgcgcttcgccaagatgaagaccgtcaccaacatctacattctc
aacctggcagtggccgacgtcctgtacatgctggggctgcctttcctggccacgcagaac
gccgcgtccttctggcccttcggccccgtcctgtgccgcctggtcatgacgctggacggc
gtcaaccagttcaccagtgtcttctgcctgacagtcatgagcgtggaccgctacctggca
gtggtgcacccgctgagctcggcccgctggcgccgcccgcgtgtggccaagctggcgagc
gccgcggcctgggtcctgtctctgtgcatgtcgctgccgctcctggtgttcgcggacgtg
caggagggcggtacctgcaacgccagctggccggagcccgtggggctgtggggcgccgtc
ttcatcatctacacggccgtgctgggcttcttcgcgccgctgctggtcatctgcctgtgc
tacctgctcatcgtggtgaaggtgagggcggcgggcgtgcgcgtgggctgcgtgcggcgg
cgctcggagcggaaggtgacgcgcatggtgttggtggtggtgctggtgtttgcgggatgt
tggctgcccttcttcaccgtcaacatcgtcaacctggccgtggcgctgccccaggagccc
gcctccgccggcctctacttcttcgtggtcatcctctcctacgccaacagctgtgccaac
cccgtcctctacggcttcctctctgacaacttccgccagagcttccagaaggttctgtgc
ctccgcaagggctctggtgccaaggacgctgacgccacggagccgcgtccagacaggatc
cggcagcagcaggaggccacgccacccgcgcaccgcgccgcagccaacgggcttatgcag
accagcaagctgtga

DBGET integrated database retrieval system