KEGG   Homo sapiens (human): 6775Help
Entry
6775              CDS       T01001                                 

Gene name
STAT4, SLEB11
Definition
signal transducer and activator of transcription 4
Orthology
K11222  
signal transducer and activator of transcription 4
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Hepatitis B
Inflammatory bowel disease (IBD)
Module
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    6775 (STAT4)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6775 (STAT4)
  Infectious diseases
   05161 Hepatitis B
    6775 (STAT4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6775 (STAT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.2-q32.3
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaagtttttggagcaggtggatcaa
ttctatgatgacaactttcccatggaaattcggcatctgttggcccaatggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcaacgattcttcttcaaaacttg
ttaatacaactggatgaacagttaggtcgtgtttccaaagagaaaaacctactcttgata
cacaatctaaaaagaattaggaaggtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaactgtttaagggaagagaggagaatattggctgcagccaac
atgcctgtccaggggcctctagagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagatctgcaagacgaatttgactacaggtataaaacaattcagaca
atggatcagagtgacaagaatagtgccatggtgaatcaggaagttttgacactgcaggaa
atgcttaacagcctcgatttcaagagaaaggaggctctcagtaaaatgacccaaatcatc
catgagacagacctgttaatgaacaccatgctcatagaagagctgcaagactggaagcgg
cggcagcaaatcgcctgcatcgggggtccactccacaatgggctcgaccagcttcagaac
tgctttacactattggcagaaagtcttttccaactgagaaggcaattggagaaactagag
gagcaatctaccaaaatgacatatgaaggtgatcccattccaatgcaaagaactcacatg
ctagaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgccaacccaccctcagaggccgttggtacttaaaaccctaattcagttc
actgtaaaactaaggctactaataaaattgccagaactaaactatcaggtaaaggttaag
gcatcaattgacaagaatgtttcaactctaagcaaccgaagatttgtactttgtggaact
aatgtcaaagccatgtctattgaagaatcttccaatgggagtctctcagtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaggtaaaggaaatgagggctgtcac
atggtgactgaagaacttcattccataacgtttgaaacacagatctgcctctatggcctg
accatagatttggagaccagctcattgcctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaacgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccacctgccacattgagtcaactactggaggtgatgagctgg
cagttttcatcgtacgttggtcgtggtcttaactcagatcaactccatatgctggcagag
aagcttacagtccaatctagctacagtgatggtcacctcacctgggccaagttctgcaag
gaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattggatcta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagcaaa
gagaaggaacggctgttgctaaaggataaaatgcctggcacctttttattaagattcagt
gaaagccatctcggaggaataactttcacctgggtggaccattctgaaagtggggaagtg
agattccactctgtagaaccctacaataaaggccggttgtctgctctgccattcgctgac
atcctgcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtac
ctatatcctgacattcccaaagacaaagccttcggtaaacactacagctctcagccttgc
gaagtttcaagaccaacagaaaggggtgacaaaggttatgttccttctgtttttatcccc
atctcaacaatccgaagtgattcaacagagccacattctccatcagaccttcttcccatg
tctccaagtgtgtatgcggtgttgagagaaaacctgagtcccacaacaattgaaactgca
atgaagtctccttattctgctgaatga

DBGET integrated database retrieval system