KEGG   Homo sapiens (human): 6779Help
Entry
6779              CDS       T01001                                 

Gene name
STATH, STR
Definition
statherin
Orthology
K13914  
statherin
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    6779 (STATH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 52 aa AA seqDB search
MKFLVFAFILALMVSMIGADSSEEYGYGPYQPVPEQPLYPQPYQPQYQQYTF
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttgtctttgccttcatcttggctctcatggtttccatgattggagctgat
tcatctgaagagtatgggtatggcccttatcagccagttccagaacaaccactataccca
caaccataccaaccacaataccaacaatataccttttaa

DBGET integrated database retrieval system