KEGG   Homo sapiens (human): 6783Help
Entry
6783              CDS       T01001                                 

Gene name
SULT1E1, EST, EST-1, ST1E1, STE
Definition
sulfotransferase family 1E, estrogen-preferring, member 1 (EC:2.8.2.4)
Orthology
K01016  
estrone sulfotransferase [EC:2.8.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    6783 (SULT1E1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.4  estrone sulfotransferase
     6783 (SULT1E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q13.1
AA seq 294 aa AA seqDB search
MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMI
YKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEK
DCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWE
KGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYT
TLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgaacttgactattatgaaaagtttgaagaagtccatgggattctaatgtat
aaagattttgtcaaatattgggataatgtggaagcgttccaggcaagaccagatgatctt
gtcattgccacctaccctaaatctggtacaacctgggttagtgaaattgtgtatatgatc
tataaagagggtgatgtggaaaagtgcaaagaagatgtaatttttaatcgaatacctttc
ctggaatgcagaaaagaaaacctcatgaatggagtaaaacaattagatgagatgaattct
cctagaattgtgaagactcatttgccacctgaacttcttcctgcctcattttgggaaaag
gattgtaagataatctatctttgccggaatgcaaaggatgtggctgtttccttttattat
ttctttctaatggtggctggtcatccaaatcctggatcctttccagagtttgtggagaaa
ttcatgcaaggacaggttccttatggttcctggtataaacatgtaaaatcttggtgggaa
aagggaaagagtccacgtgtactatttcttttctacgaagacctgaaagaggatatcaga
aaagaggtgataaaattgatacatttcctggaaaggaagccatcagaggagcttgtggac
aggattatacatcatacttcgttccaagagatgaagaacaatccatccacaaattacaca
acactgccagacgaaattatgaaccagaaattgtcgcccttcatgagaaagggaattaca
ggagactggaaaaatcactttacagtagccctgaatgaaaaatttgataaacattatgag
cagcaaatgaaggaatctacactgaagtttcgaactgagatctaa

DBGET integrated database retrieval system