KEGG   Homo sapiens (human): 6786Help
Entry
6786              CDS       T01001                                 

Gene name
STIM1, D11S4896E, GOK, IMD10, STRMK, TAM, TAM1
Definition
(RefSeq) stromal interaction molecule 1
  KO
K16059  
stromal interaction molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Platelet activation
Disease
H00093  
Combined immunodeficiencies (CIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6786 (STIM1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6786 (STIM1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   6786 (STIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 685 aa AA seqDB search
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatgtatgcgtccgtcttgccctgtggctcctctggggactcctcctgcaccagggc
cagagcctcagccatagtcacagtgagaaggcgacaggaaccagctcgggggccaactct
gaggagtccactgcagcagagttttgccgaattgacaagcccctgtgtcacagtgaggat
gagaaactcagcttcgaggcagtccgtaacatccacaaactgatggacgatgatgccaat
ggtgatgtggatgtggaagaaagtgatgagttcctgagggaagacctcaattaccatgac
ccaacagtgaaacacagcaccttccatggtgaggataagctcatcagcgtggaggacctg
tggaaggcatggaagtcatcagaagtatacaattggaccgtggatgaggtggtacagtgg
ctgatcacatatgtggagctgcctcagtatgaggagaccttccggaagctgcagctcagt
ggccatgccatgccaaggctggctgtcaccaacaccaccatgacagggactgtgctgaag
atgacagaccggagtcatcggcagaagctgcagctgaaggctctggatacagtgctcttt
gggcctcctctcttgactcgccataatcacctcaaggacttcatgctggtggtgtctatc
gttattggtgtgggcggctgctggtttgcctatatccagaaccgttactccaaggagcac
atgaagaagatgatgaaggacttggaggggttacaccgagctgagcagagtctgcatgac
cttcaggaaaggctgcacaaggcccaggaggagcaccgcacagtggaggtggagaaggtc
catctggaaaagaagctgcgcgatgagatcaaccttgctaagcaggaagcccagcggctg
aaggagctgcgggagggtactgagaatgagcggagccgccaaaaatatgctgaggaggag
ttggagcaggttcgggaggccttgaggaaagcagagaaggagctagaatctcacagctca
tggtatgctccagaggcccttcagaagtggctgcagctgacacatgaggtggaggtgcaa
tattacaacatcaagaagcaaaatgctgagaagcagctgctggtggccaaggagggggct
gagaagataaaaaagaagagaaacacactctttggcaccttccacgtggcccacagctct
tccctggatgatgtagatcataaaattctaacagctaagcaagcactgagcgaggtgaca
gcagcattgcgggagcgcctgcaccgctggcaacagatcgagatcctctgtggcttccag
attgtcaacaaccctggcatccactcactggtggctgccctcaacatagaccccagctgg
atgggcagtacacgccccaaccctgctcacttcatcatgactgacgacgtggatgacatg
gatgaggagattgtgtctcccttgtccatgcagtcccctagcctgcagagcagtgttcgg
cagcgcctgacggagccacagcatggcctgggatctcagagggatttgacccattccgat
tcggagtcctccctccacatgagtgaccgccagcgtgtggcccccaaacctcctcagatg
agccgtgctgcagacgaggctctcaatgccatgacttccaatggcagccaccggctgatc
gagggggtccacccagggtctctggtggagaaactgcctgacagccctgccctggccaag
aaggcattactggcgctgaaccatgggctggacaaggcccacagcctgatggagctgagc
ccctcagccccacctggtggctctccacatttggattcttcccgttctcacagccccagc
tccccagacccagacacaccatctccagttggggacagccgagccctgcaagccagccga
aacacacgcattccccacctggctggcaagaaggctgtggctgaggaggataatggctct
attggcgaggaaacagactccagcccaggccggaagaagtttcccctcaaaatctttaag
aagcctcttaagaagtag

DBGET integrated database retrieval system