KEGG   Homo sapiens (human): 6788Help
Entry
6788              CDS       T01001                                 

Gene name
STK3, KRS1, MST2
Definition
(RefSeq) serine/threonine kinase 3 (EC:2.7.11.1)
  KO
K04412  
serine/threonine kinase 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Hippo signaling pathway
Hippo signaling pathway -multiple species
Module
Hippo signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6788 (STK3)
   04390 Hippo signaling pathway
    6788 (STK3)
   04392 Hippo signaling pathway - multiple species
    6788 (STK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   6788 (STK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22.2
AA seq 491 aa AA seqDB search
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgccggcgcctaagagtaaactaaaaaagctgagtgaagacagtttgact
aagcagcctgaagaagtttttgatgtattagagaagcttggagaagggtcttatggaagt
gtatttaaagcaatacacaaggaatccggtcaagttgtcgcaattaaacaagtacctgtt
gaatcagatcttcaggaaataatcaaagaaatttccataatgcagcaatgtgacagccca
tatgttgtaaagtactatggcagttattttaagaatacagacctctggattgttatggag
tactgtggcgctggctctgtctcagacataattagattacgaaacaagacattaatagaa
gatgaaattgcaaccattcttaaatctacattgaaaggactagaatatttgcactttatg
agaaaaatacacagagatataaaagctggaaatattctcctcaatacagaaggacatgca
aaattggcagattttggagtggctggtcagttaacagatacaatggcaaaacgcaatact
gtaataggaactccattttggatggctcctgaggtgattcaagaaataggctataactgt
gtggccgacatctggtcccttggcattacttctatagaaatggctgaaggaaaacctcct
tatgctgatatacatccaatgagggctatttttatgattcccacaaatccaccaccaaca
ttcagaaagccagaactttggtccgatgatttcaccgattttgttaaaaagtgtttggtg
aagaatcctgagcagagagctactgcaacacaacttttacagcatccttttatcaagaat
gccaaacctgtatcaatattaagagacctgatcacagaagctatggagatcaaagctaaa
agacatgaggaacagcaacgagaattggaagaggaagaagaaaattcggatgaagatgag
ctggattcccacaccatggtgaagactagtgtggagagtgtgggcaccatgcgggccaca
agcacgatgagtgaaggggcccagaccatgattgaacataatagcacgatgttggaatcc
gacttggggaccatggtgataaacagtgaggatgaggaagaagaagatggaactatgaaa
agaaatgcaacctcaccacaagtacaaagaccatctttcatggactactttgataagcaa
gacttcaagaataagagtcacgaaaactgtaatcagaacatgcatgaacccttccctatg
tccaaaaacgtttttcctgataactggaaagttcctcaagatggagactttgactttttg
aaaaatctaagtttagaagaactacagatgcggttaaaagcactggaccccatgatggaa
cgggagatagaagaacttcgtcagagatacactgcgaaaagacagcccattctggatgcg
atggatgcaaagaaaagaaggcagcaaaacttttga

DBGET integrated database retrieval system