KEGG   Homo sapiens (human): 6788Help
Entry
6788              CDS       T01001                                 

Gene name
STK3, KRS1, MST2
Definition
serine/threonine kinase 3 (EC:2.7.11.1)
Orthology
K04412  
serine/threonine kinase 3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Hippo signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22.2
AA seq 519 aa AA seqDB search
MLQLMDSGITICLRNGAASVFKKKEWSTQGEENKQDSKLKKLSEDSLTKQPEEVFDVLEK
LGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKN
TDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNI
LLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSI
EMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQL
LQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVE
SVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPS
FMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRL
KALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttacaactcatggacagtggcattaccatctgccttaggaacggagcagcctctgtc
ttcaagaaaaaagaatggagcacacaaggagaagaaaacaagcaagacagtaaactaaaa
aagctgagtgaagacagtttgactaagcagcctgaagaagtttttgatgtattagagaag
cttggagaagggtcttatggaagtgtatttaaagcaatacacaaggaatccggtcaagtt
gtcgcaattaaacaagtacctgttgaatcagatcttcaggaaataatcaaagaaatttcc
ataatgcagcaatgtgacagcccatatgttgtaaagtactatggcagttattttaagaat
acagacctctggattgttatggagtactgtggcgctggctctgtctcagacataattaga
ttacgaaacaagacattaatagaagatgaaattgcaaccattcttaaatctacattgaaa
ggactagaatatttgcactttatgagaaaaatacacagagatataaaagctggaaatatt
ctcctcaatacagaaggacatgcaaaattggcagattttggagtggctggtcagttaaca
gatacaatggcaaaacgcaatactgtaataggaactccattttggatggctcctgaggtg
attcaagaaataggctataactgtgtggccgacatctggtcccttggcattacttctata
gaaatggctgaaggaaaacctccttatgctgatatacatccaatgagggctatttttatg
attcccacaaatccaccaccaacattcagaaagccagaactttggtccgatgatttcacc
gattttgttaaaaagtgtttggtgaagaatcctgagcagagagctactgcaacacaactt
ttacagcatccttttatcaagaatgccaaacctgtatcaatattaagagacctgatcaca
gaagctatggagatcaaagctaaaagacatgaggaacagcaacgagaattggaagaggaa
gaagaaaattcggatgaagatgagctggattcccacaccatggtgaagactagtgtggag
agtgtgggcaccatgcgggccacaagcacgatgagtgaaggggcccagaccatgattgaa
cataatagcacgatgttggaatccgacttggggaccatggtgataaacagtgaggatgag
gaagaagaagatggaactatgaaaagaaatgcaacctcaccacaagtacaaagaccatct
ttcatggactactttgataagcaagacttcaagaataagagtcacgaaaactgtaatcag
aacatgcatgaacccttccctatgtccaaaaacgtttttcctgataactggaaagttcct
caagatggagactttgactttttgaaaaatctaagtttagaagaactacagatgcggtta
aaagcactggaccccatgatggaacgggagatagaagaacttcgtcagagatacactgcg
aaaagacagcccattctggatgcgatggatgcaaagaaaagaaggcagcaaaacttttga

DBGET integrated database retrieval system