KEGG   Homo sapiens (human): 6790Help
Entry
6790              CDS       T01001                                 

Gene name
AURKA, AIK, ARK1, AURA, AURORA2, BTAK, PPP1R47, STK15, STK6, STK7
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Drug target
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13
AA seq 403 aa AA seqDB search
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcaggacctgttaaggctacagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgtaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcttcccagcgcattcctttgcaa
gcacaaaagcttgtctccagtcacaagccggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccactgaataacacccaaaagagcaagcag
cccctgccatcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaagcaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtagaaatacagtcccaccttcggcatcctaatattcttagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtttataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacttatataacagaattg
gcaaatgccctgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gaatttttagttgggaagcctccttttgaggcaaacacataccaagagacctacaaaaga
atatcacgggttgaattcacattccctgactttgtaacagagggagccagggacctcatt
tcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaacac
ccctggatcacagcaaattcatcaaaaccatcaaattgccaaaacaaagaatcagctagc
aaacagtcttag

DBGET integrated database retrieval system