KEGG   Homo sapiens (human): 6790Help
Entry
6790              CDS       T01001                                 

Gene name
AURKA, AIK, ARK1, AURA, AURORA2, BTAK, PPP1R47, STK15, STK6, STK7
Definition
(RefSeq) aurora kinase A (EC:2.7.11.1)
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6790 (AURKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6790 (AURKA)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   6790 (AURKA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6790 (AURKA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    6790 (AURKA)
   Spindle formation proteins
    6790 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    6790 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13
AA seq 403 aa AA seqDB search
MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQ
AQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKN
EESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRR
EVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITEL
ANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEM
IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcaggacctgttaaggctacagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgtaaat
agtggccaggctcagcgggtcttgtgtccttcaaattcttcccagcgcattcctttgcaa
gcacaaaagcttgtctccagtcacaagccggttcagaatcagaagcagaagcaattgcag
gcaaccagtgtacctcatcctgtctccaggccactgaataacacccaaaagagcaagcag
cccctgccatcggcacctgaaaataatcctgaggaggaactggcatcaaaacagaaaaat
gaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctgggt
aaaggaaagtttggtaatgtttatttggcaagagaaaagcaaagcaagtttattctggct
cttaaagtgttatttaaagctcagctggagaaagccggagtggagcatcagctcagaaga
gaagtagaaatacagtcccaccttcggcatcctaatattcttagactgtatggttatttc
catgatgctaccagagtctacctaattctggaatatgcaccacttggaacagtttataga
gaacttcagaaactttcaaagtttgatgagcagagaactgctacttatataacagaattg
gcaaatgccctgtcttactgtcattcgaagagagttattcatagagacattaagccagag
aacttacttcttggatcagctggagagcttaaaattgcagattttgggtggtcagtacat
gctccatcttccaggaggaccactctctgtggcaccctggactacctgccccctgaaatg
attgaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgctat
gaatttttagttgggaagcctccttttgaggcaaacacataccaagagacctacaaaaga
atatcacgggttgaattcacattccctgactttgtaacagagggagccagggacctcatt
tcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaacac
ccctggatcacagcaaattcatcaaaaccatcaaattgccaaaacaaagaatcagctagc
aaacagtcttag

DBGET integrated database retrieval system