KEGG   Homo sapiens (human): 6794Help
Entry
6794              CDS       T01001                                 

Gene name
STK11, LKB1, PJS, hLKB1
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04530  Tight junction
hsa04920  Adipocytokine signaling pathway
Disease
H00019  Pancreatic cancer
H00666  Peutz-Jeghers syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6794 (STK11)
   04151 PI3K-Akt signaling pathway
    6794 (STK11)
   04152 AMPK signaling pathway
    6794 (STK11)
   04150 mTOR signaling pathway
    6794 (STK11)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    6794 (STK11)
  Cellular community - eukaryotes
   04530 Tight junction
    6794 (STK11)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    6794 (STK11)
  Aging
   04211 Longevity regulating pathway - mammal
    6794 (STK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6794 (STK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   6794 (STK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 6794
NCBI-ProteinID: NP_000446
OMIM: 602216
HGNC: 11389
Ensembl: ENSG00000118046
Vega: OTTHUMG00000180118
Pharos: Q15831(Tchem)
UniProt: Q15831 A0A0S2Z4D1
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 433 aa AA seqDB search
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg
aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca
ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc
cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg
cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat
ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg
agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc
agcagcaagatccgccggctgtcggcctgcaagcagcagtga

DBGET integrated database retrieval system