KEGG   Homo sapiens (human): 6799Help
Entry
6799              CDS       T01001                                 

Gene name
SULT1A2, HAST4, P-PST, ST1A2, STP2, TSPST2
Definition
sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2 (EC:2.8.2.1)
Orthology
K01014  
aryl sulfotransferase [EC:2.8.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    6799 (SULT1A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.1  aryl sulfotransferase
     6799 (SULT1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.1
AA seq 295 aa AA seqDB search
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNY
TTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagctgatccaggacatctctcgcccgccactggagtacgtgaagggggtcccgctc
atcaagtactttgcagaggcactggggcccctgcagagcttccaggcccggcctgatgac
ctgctcatcagcacctaccccaagtccggcaccacctgggtgagccagattctggacatg
atctaccagggcggtgacctggaaaagtgtcaccgagctcccatcttcatgcgggtgccc
ttccttgagttcaaagtcccagggattccctcagggatggagactctgaaaaacacacca
gccccacgactcctgaagacacacctgcccctggctctgctcccccagactctgttggat
cagaaggtcaaggtggtctatgttgcccgcaacgcaaaggatgtggcggtttcctactac
cacttctaccacatggccaaagtgtaccctcaccctgggacctgggaaagcttcctggag
aagttcatggctggagaagtgtcctatgggtcctggtaccagcacgtgcaagagtggtgg
gagctgagccgcacccaccctgttctctacctcttctatgaagacatgaaggagaacccc
aaaagggagattcaaaagatcctggagtttgtggggcgctccctgccagaggagactgtg
gacctcatggttgagcacacgtcgttcaaggagatgaagaagaaccctatgaccaactac
accaccgtccgccgggagttcatggaccacagcatctcccccttcatgaggaaaggcatg
gctggggactggaagaccaccttcaccgtggcgcagaatgagcgcttcgatgcggactat
gcggagaagatggcaggctgcagcctcagcttccgctctgagctgtga

DBGET integrated database retrieval system