KEGG   Homo sapiens (human): 680Help
Entry
680               CDS       T01001                                 

Gene name
BRS3, BB3
Definition
(RefSeq) bombesin like receptor 3
  KO
K04170  
bombesin-like receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    680 (BRS3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Bombesin
    680 (BRS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xq26.3
AA seq 399 aa AA seqDB search
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaggcagcctcactcacctaatcagactttaatttcaatcacaaatgacaca
gaatcatcaagctctgtggtttctaacgataacacaaataaaggatggagcggggacaac
tctccaggaatagaagcattgtgtgccatctatattacttatgctgtgatcatttcagtg
ggcatccttggaaatgctattctcatcaaagtctttttcaagaccaaatccatgcaaaca
gttccaaatattttcatcaccagcctggcttttggagatcttttacttctgctaacttgt
gtgccagtggatgcaactcactaccttgcagaaggatggctgttcggaagaattggttgt
aaggtgctctctttcatccggctcacttctgttggtgtgtcagtgttcacattaacaatt
ctcagcgctgacagatacaaggcagttgtgaagccacttgagcgacagccctccaatgcc
atcctgaagacttgtgtaaaagctggctgcgtctggatcgtgtctatgatatttgctcta
cctgaggctatattttcaaatgtatacacttttcgagatcccaataaaaatatgacattt
gaatcatgtacctcttatcctgtctctaagaagctcttgcaagaaatacattctctgctg
tgcttcttagtgttctacattattccactctctattatctctgtctactattccttgatt
gctaggaccctttacaaaagcaccctgaacatacctactgaggaacaaagccatgcccgt
aagcagattgaatcccgaaagagaattgccagaacggtattggtgttggtggctctgttt
gccctctgctggttgccaaatcacctcctgtacctctaccattcattcacttctcaaacc
tatgtagacccctctgccatgcatttcattttcaccattttctctcgggttttggctttc
agcaattcttgcgtaaacccctttgctctctactggctgagcaaaagcttccagaagcat
tttaaagctcagttgttctgttgcaaggcggagcggcctgagcctcctgttgctgacacc
tctcttaccaccctggctgtgatgggaacggtcccgggcactgggagcatacagatgtct
gaaattagtgtgacctcgttcactgggtgtagtgtgaagcaggcagaggacagattctag

DBGET integrated database retrieval system