KEGG   Homo sapiens (human): 6810Help
Entry
6810              CDS       T01001                                 

Gene name
STX4, STX4A, p35-2
Definition
syntaxin 4
Orthology
K13502  
syntaxin 4
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Vasopressin-regulated water reabsorption
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 219 aa AA seqDB search
MKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELI
NKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQ
ALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEH
VKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggagctgcagaacctgcgcgatgagatcaaacagctggggagggagatccgc
ctgcagctgaaggccatagagccccagaaggaggaagctgatgagaactataactccgtc
aacacaagaatgagaaaaacccagcatggggtcctgtcccagcaattcgtggagctcatc
aacaagtgcaattcaatgcagtccgaataccgggagaagaacgtggagcggattcggagg
cagctgaagatcaccaatgctgggatggtgtctgatgaggagttggagcagatgctggac
agtgggcaaagcgaggtgtttgtgtccaatatcctgaaggacacgcaggtgactcgacag
gccttaaatgagatctcggcccggcacagtgagatccagcagcttgaacgcagtattcgt
gagctgcacgacatattcacttttctggctaccgaagtggagatgcagggggagatgatc
aatcggattgagaagaacatcctgagctcagcggactacgtggaacgtgggcaggagcac
gtcaagacggccctggagaaccagaagaaggcgaggaagaagaaagtcttgattgccatc
tgtgtgtccatcaccgtcgtcctcctagcagtcatcattggcgtcacagtggttggataa

DBGET integrated database retrieval system