KEGG   Homo sapiens (human): 6810Help
Entry
6810              CDS       T01001                                 

Gene name
STX4, STX4A, p35-2
Definition
syntaxin 4
Orthology
K13502  
syntaxin 4
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6810 (STX4)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    6810 (STX4)
SNAREs [BR:hsa04131]
 Syntaxin (Qa)
  Stx-PM
   6810 (STX4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6810 (STX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 219 aa AA seqDB search
MKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELI
NKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQ
ALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEH
VKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggagctgcagaacctgcgcgatgagatcaaacagctggggagggagatccgc
ctgcagctgaaggccatagagccccagaaggaggaagctgatgagaactataactccgtc
aacacaagaatgagaaaaacccagcatggggtcctgtcccagcaattcgtggagctcatc
aacaagtgcaattcaatgcagtccgaataccgggagaagaacgtggagcggattcggagg
cagctgaagatcaccaatgctgggatggtgtctgatgaggagttggagcagatgctggac
agtgggcaaagcgaggtgtttgtgtccaatatcctgaaggacacgcaggtgactcgacag
gccttaaatgagatctcggcccggcacagtgagatccagcagcttgaacgcagtattcgt
gagctgcacgacatattcacttttctggctaccgaagtggagatgcagggggagatgatc
aatcggattgagaagaacatcctgagctcagcggactacgtggaacgtgggcaggagcac
gtcaagacggccctggagaaccagaagaaggcgaggaagaagaaagtcttgattgccatc
tgtgtgtccatcaccgtcgtcctcctagcagtcatcattggcgtcacagtggttggataa

DBGET integrated database retrieval system