KEGG   Homo sapiens (human): 6810Help
Entry
6810              CDS       T01001                                 

Gene name
STX4, STX4A, p35-2
Definition
(RefSeq) syntaxin 4
  KO
K13502  syntaxin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6810 (STX4)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    6810 (STX4)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    6810 (STX4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6810 (STX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 DUF3671 GlutR_dimer PilO T2SSF Lectin_N DUF16 AAA_13 NPV_P10 ERp29 DUF4162 Rax2 DUF848
Motif
Other DBs
NCBI-GeneID: 6810
NCBI-ProteinID: NP_004595
OMIM: 186591
HGNC: 11439
Ensembl: ENSG00000103496
Vega: OTTHUMG00000132404
Pharos: Q12846(Tbio)
UniProt: Q12846
Position
16p11.2
AA seq 297 aa AA seqDB search
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQ
ELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNT
RMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSG
QSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINR
IEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaggacccacgagctgagacagggggatgacagctcggacgaagaggacaag
gagcgggtcgcgctggtggtgcacccgggcacggcacggctggggagcccggacgaggag
ttcttccacaaggtccggacaattcggcagactattgtcaaactggggaataaagtccag
gagttggagaaacagcaggtcaccatcctggccacgccccttcccgaggagagcatgaag
caggagctgcagaacctgcgcgatgagatcaaacagctggggagggagatccgcctgcag
ctgaaggccatagagccccagaaggaggaagctgatgagaactataactccgtcaacaca
agaatgagaaaaacccagcatggggtcctgtcccagcaattcgtggagctcatcaacaag
tgcaattcaatgcagtccgaataccgggagaagaacgtggagcggattcggaggcagctg
aagatcaccaatgctgggatggtgtctgatgaggagttggagcagatgctggacagtggg
caaagcgaggtgtttgtgtccaatatcctgaaggacacgcaggtgactcgacaggcctta
aatgagatctcggcccggcacagtgagatccagcagcttgaacgcagtattcgtgagctg
cacgacatattcacttttctggctaccgaagtggagatgcagggggagatgatcaatcgg
attgagaagaacatcctgagctcagcggactacgtggaacgtgggcaggagcacgtcaag
acggccctggagaaccagaagaaggcgaggaagaagaaagtcttgattgccatctgtgtg
tccatcaccgtcgtcctcctagcagtcatcattggcgtcacagtggttggataa

DBGET integrated database retrieval system