KEGG   Homo sapiens (human): 6812Help
Entry
6812              CDS       T01001                                 

Gene name
STXBP1, MUNC18-1, NSEC1, P67, RBSEC1, UNC18
Definition
syntaxin binding protein 1
Orthology
K15292  
syntaxin-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Disease
H00606  
Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    6812 (STXBP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6812 (STXBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.1
AA seq 594 aa AA seqDB search
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVK
SRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPS
SPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQG
TVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTP
IIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIF
ILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcccccattggcctcaaagctgttgtcggagagaagattatgcatgatgtgataaag
aaggtcaagaagaagggggaatggaaggtgctggtggtggatcagttaagcatgaggatg
ctgtcctcctgctgcaagatgacagacatcatgaccgagggcataacgattgtggaagat
atcaataagcgcagagagccgctccccagcctggaggctgtgtatctcatcactccatcc
gagaagtccgtccactctctcatcagtgactttaaggacccgccgactgctaaataccgg
gctgcacacgtcttcttcactgactcttgtccagatgccctgtttaatgaactggtaaaa
tcccgagcagccaaagtcatcaaaactctgacggaaatcaatattgcatttctcccgtat
gaatcccaggtctattccttggactctgctgactctttccaaagcttctacagtccccac
aaggctcagatgaagaatcctatactggagcgcctggcagagcagatcgcgaccctttgt
gccaccctgaaggagtacccggctgtgcggtatcggggggaatacaaggacaatgccctg
ctggctcagctaatccaggacaagctcgatgcctataaagctgatgatccaacaatgggg
gagggcccagacaaggcacgctcccagctcctgatcctggatcgaggctttgaccccagc
tcccctgtgctccatgaattgacttttcaggctatgagttatgatctgctgcctatcgaa
aatgatgtatacaagtatgagaccagcggcatcggggaggcacgggtgaaggaggtgctc
ctggacgaggacgacgacctgtggatagcactgcgccacaagcacatcgcagaggtgtcc
caggaagtcacccggtctctgaaagatttttcttctagcaagagaatgaatactggagag
aagaccaccatgcgggacctgtcccagatgctgaagaagatgcctcagtaccagaaagag
ctcagcaagtactccacccacctgcaccttgctgaggactgtatgaagcattaccaaggc
accgtagacaaactctgccgagtggagcaggacctggccatgggcacagatgctgaggga
gagaagatcaaggaccctatgcgagccatcgtccccattctgctggatgccaatgtcagc
acttatgacaaaatccgcatcatccttctctacatctttttgaagaatggcatcacggag
gaaaacctgaacaaactgatccagcacgcccagatacccccggaggatagtgagatcatc
accaacatggctcacctcggcgtgcccatcgtcaccgattccacgctgcgtcgccggagc
aagccggagcggaaggaacgcatcagcgagcagacctaccagctctcacggtggactccg
attatcaaggacatcatggaggacactattgaggacaaacttgacaccaaacactaccct
tatatctctacccgttcctctgcctccttcagcaccaccgccgtcagcgcccgctatggg
cactggcataagaacaaggccccaggcgagtaccgcagtggcccccgcctcatcattttc
atccttgggggtgtgagcctgaatgagatgcgctgcgcctacgaggtgacccaggccaac
ggaaagtgggaggtgctgataggatccacacacatcctcaccccacagaaactgctggac
acactgaagaaactgaataaaacagatgaagaaataagcagttaa

DBGET integrated database retrieval system