KEGG   Homo sapiens (human): 682Help
Entry
682               CDS       T01001                                 

Gene name
BSG, 5F7, CD147, EMMPRIN, OK, TCSF
Definition
(RefSeq) basigin (Ok blood group)
  KO
K06535  
basigin
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   682 (BSG)
Cellular antigens [BR:hsa04090]
 Proteins
  682 (BSG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 385 aa AA seqDB search
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEG
QGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLT
RAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKE
DALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAML
VCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDA
GSAPLKSSGQHQNDKGKNVRQRNSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgctgttcgtgctgctgggattcgcgctgctgggcacccacggagcctcc
ggggctgccggcttcgtccaggcgccgctgtcccagcagaggtgggtggggggcagtgtg
gagctgcactgcgaggccgtgggcagcccggtgcccgagatccagtggtggtttgaaggg
cagggtcccaacgacacctgctcccagctctgggacggcgcccggctggaccgcgtccac
atccacgccacctaccaccagcacgcggccagcaccatctccatcgacacgctcgtggag
gaggacacgggcacttacgagtgccgggccagcaacgacccggatcgcaaccacctgacc
cgggcgcccagggtcaagtgggtccgcgcccaggcagtcgtgctagtcctggaacccggc
acagtcttcactaccgtagaagaccttggctccaagatactcctcacctgctccttgaat
gacagcgccacagaggtcacagggcaccgctggctgaaggggggcgtggtgctgaaggag
gacgcgctgcccggccagaaaacggagttcaaggtggactccgacgaccagtggggagag
tactcctgcgtcttcctccccgagcccatgggcacggccaacatccagctccacgggcct
cccagagtgaaggctgtgaagtcgtcagaacacatcaacgagggggagacggccatgctg
gtctgcaagtcagagtccgtgccacctgtcactgactgggcctggtacaagatcactgac
tctgaggacaaggccctcatgaacggctccgagagcaggttcttcgtgagttcctcgcag
ggccggtcagagctacacattgagaacctgaacatggaggccgaccccggccagtaccgg
tgcaacggcaccagctccaagggctccgaccaggccatcatcacgctccgcgtgcgcagc
cacctggccgccctctggcccttcctgggcatcgtggctgaggtgctggtgctggtcacc
atcatcttcatctacgagaagcgccggaagcccgaggacgtcctggatgatgacgacgcc
ggctctgcacccctgaagagcagcgggcagcaccagaatgacaaaggcaagaacgtccgc
cagaggaactcttcctga

DBGET integrated database retrieval system