KEGG   Homo sapiens (human): 6820Help
Entry
6820              CDS       T01001                                 

Gene name
SULT2B1, HSST2
Definition
(RefSeq) sulfotransferase family 2B member 1
  KO
K01015  
alcohol sulfotransferase [EC:2.8.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    6820 (SULT2B1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.2  alcohol sulfotransferase
     6820 (SULT2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 365 aa AA seqDB search
MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRD
DDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPR
LMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFL
KGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSV
VAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ
MRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETP
HPRPS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcccgccgagccccagatcccgggcttgtgggacacctatgaagatgacatc
tcggaaatcagccagaagttgccaggtgaatacttccggtacaagggcgtccccttcccc
gtcggcctgtactcgctcgagagcatcagcttggcggagaacacccaagatgtgcgggac
gacgacatctttatcatcacctaccccaagtcaggcacgacctggatgatcgagatcatc
tgcttaatcctgaaggaaggggatccatcctggatccgctccgtgcccatctgggagcgg
gcaccctggtgtgagaccattgtgggtgccttcagcctcccggaccagtacagcccccgc
ctcatgagctcccatcttcccatccagatcttcaccaaggccttcttcagctccaaggcc
aaggtgatctacatgggccgcaacccccgggacgttgtggtctccctctatcattactcc
aagatcgccgggcagttaaaggacccgggcacacccgaccagttcctgagggacttcctc
aaaggcgaagtgcagtttggctcctggttcgaccacattaagggctggcttcggatgaag
ggcaaagacaacttcctatttatcacctacgaggagctgcagcaggacttacagggctcc
gtggagcgcatctgtgggttcctgggccgtccgctgggcaaggaggcactgggctccgtc
gtggcacactcaaccttcagcgccatgaaggccaacaccatgtccaactacacgctgctg
cctcccagcctgctggaccaccgtcgcggggccttcctccggaaaggggtctgcggcgac
tggaagaaccacttcacggtggcccagagcgaagccttcgatcgtgcctaccgcaagcag
atgcgggggatgccgaccttcccctgggatgaagacccggaggaggacggcagcccagat
cctgagcccagccctgagcctgagcccaagcccagccttgagcccaacaccagcctggag
cgtgagcccagacccaactccagccccagccccagccccggccaggcctctgagaccccg
cacccacgaccctcataa

DBGET integrated database retrieval system