KEGG   Homo sapiens (human): 6820Help
Entry
6820              CDS       T01001                                 

Gene name
SULT2B1, HSST2
Definition
sulfotransferase family, cytosolic, 2B, member 1 (EC:2.8.2.2)
Orthology
K01015  
alcohol sulfotransferase [EC:2.8.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:hsa00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 350 aa AA seqDB search
MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTW
MIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAF
FSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKG
WLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMS
NYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEE
DGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcccccacctttccacagccagaagttgccaggtgaatacttccggtacaag
ggcgtccccttccccgtcggcctgtactcgctcgagagcatcagcttggcggagaacacc
caagatgtgcgggacgacgacatctttatcatcacctaccccaagtcaggcacgacctgg
atgatcgagatcatctgcttaatcctgaaggaaggggatccatcctggatccgctccgtg
cccatctgggagcgggcaccctggtgtgagaccattgtgggtgccttcagcctcccggac
cagtacagcccccgcctcatgagctcccatcttcccatccagatcttcaccaaggccttc
ttcagctccaaggccaaggtgatctacatgggccgcaacccccgggacgttgtggtctcc
ctctatcattactccaagatcgccgggcagttaaaggacccgggcacacccgaccagttc
ctgagggacttcctcaaaggcgaagtgcagtttggctcctggttcgaccacattaagggc
tggcttcggatgaagggcaaagacaacttcctatttatcacctacgaggagctgcagcag
gacttacagggctccgtggagcgcatctgtgggttcctgggccgtccgctgggcaaggag
gcactgggctccgtcgtggcacactcaaccttcagcgccatgaaggccaacaccatgtcc
aactacacgctgctgcctcccagcctgctggaccaccgtcgcggggccttcctccggaaa
ggggtctgcggcgactggaagaaccacttcacggtggcccagagcgaagccttcgatcgt
gcctaccgcaagcagatgcgggggatgccgaccttcccctgggatgaagacccggaggag
gacggcagcccagatcctgagcccagccctgagcctgagcccaagcccagccttgagccc
aacaccagcctggagcgtgagcccagacccaactccagccccagccccagccccggccag
gcctctgagaccccgcacccacgaccctcataa

DBGET integrated database retrieval system