KEGG   Homo sapiens (human): 6821Help
Entry
6821              CDS       T01001                                 

Gene name
SUOX
Definition
sulfite oxidase (EC:1.8.3.1)
Orthology
K00387  
sulfite oxidase [EC:1.8.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur metabolism
Disease
H01237  
Sulfite oxidase deficiency
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hsa00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.2
AA seq 545 aa AA seqDB search
MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGT
LLGLGAVLAYQDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPG
GPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDP
VRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGG
QSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCD
VLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRD
HGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI
QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQ
RPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVH
VYVSP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgcacagagctgtggtcctcaggctccaacaggcctgcagactcaagtca
atcccctcaaggatctgcattcaggcctgctccacaaatgattcatttcagccccagcgc
cccagcctcaccttctctggtgataactccagcacccagggatggagagtcatggggacc
ctattaggtctcggtgcagtgttggcctatcaggaccatcggtgtagggctgctcaggag
tcaacacacatatacactaaggaggaagtgagttcccacaccagccctgagactgggatc
tgggtgactctgggctctgaggtctttgatgtcacagaatttgtggacctacatccaggg
gggccttcaaagctgatgctagcagctgggggtcccctagagcccttctgggccctctat
gctgttcacaaccagtcccatgtgcgtgagttactggctcagtacaagattggggagctg
aatcctgaagacaaggtagcccccaccgtggagacctctgacccttatgctgatgatcct
gtacgtcacccagccctgaaggtcaacagccagcggccctttaatgcagagcctccccct
gagctgctgacagaaaactacatcacacccaaccctatcttcttcacccggaaccatctg
cctgtacctaacctggatccagacacctatcgcttacacgtagtaggagcacctgggggt
cagtcactgtctctttccctggatgacttgcacaactttcccaggtacgagatcacagtc
actctgcagtgtgccggcaaccgacgctctgagatgactcaggtcaaagaagtaaaaggt
ctggagtggagaacaggagccatcagcactgcacgctgggctggggcacggctctgtgat
gtgttagcccaggctggccaccaactctgtgaaactgaggcccacgtctgctttgaggga
ctggactcagaccctactgggactgcctatggagcatccatccctctggctcgggccatg
gaccctgaagctgaggtcctgctggcatatgagatgaatgggcagcctctgccacgtgac
cacggcttccctgtgcgtgtggtggttcctggagtggtgggtgcccgccatgtcaaatgg
ctgggcagagtgagtgtgcagccagaggaaagttacagccactggcaacggcgggattac
aaaggcttctctccatctgtggactgggagactgtagattttgactctgctccatccatt
caggaacttcctgtccagtcggccatcacagagccccgggatggagagactgtagaatca
ggggaggtgaccatcaagggctatgcatggagtggtggtggcagggctgtgatccgggtg
gatgtgtctctggatgggggcctaacctggcaggtggctaagctggatggagaggaacag
cgccccaggaaggcctgggcatggcgtctgtggcagttgaaagcccctgtgccagctgga
caaaaggaactgaacattgtttgtaaggctgtggatgatggttacaatgtgcagccagac
accgtggccccaatctggaacctgcgaggtgttctcagcaatgcctggcatcgtgtccat
gtctatgtctccccatga

DBGET integrated database retrieval system