KEGG   Homo sapiens (human): 6822Help
Entry
6822              CDS       T01001                                 

Gene name
SULT2A1, DHEA-ST, DHEAS, HST, ST2, ST2A1, ST2A3, STD, hSTa
Definition
sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (EC:2.8.2.14)
Orthology
K11822  
bile-salt sulfotransferase [EC:2.8.2.14]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Bile secretion
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    6822 (SULT2A1)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6822 (SULT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    6822 (SULT2A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.14  bile-salt sulfotransferase
     6822 (SULT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 285 aa AA seqDB search
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgatttcttatggtttgaaggcatagctttccctactatgggtttcagatcc
gaaaccttaagaaaagtacgtgatgagttcgtgataagggatgaagatgtaataatattg
acttaccccaaatcaggaacaaactggttggctgagattctctgcctgatgcactccaag
ggggatgccaagtggatccaatctgtgcccatctgggagcgatcaccctgggtagagagt
gagattgggtatacagcactcagtgaaacggagagtccacgtttattctcctcccacctc
cccatccagttattccccaagtctttcttcagttccaaggccaaggtgatttatctcatg
agaaatcccagagatgttttggtgtctggttattttttctggaaaaacatgaagtttatt
aagaaaccaaagtcatgggaagaatattttgaatggttttgtcaaggaactgtgctatat
gggtcatggtttgaccacattcatggctggatgcccatgagagaggagaaaaacttcctg
ttactgagttatgaggagctgaaacaggacacaggaagaaccatagagaagatctgtcaa
ttcctgggaaagacgttagaacccgaagaactgaacttaattctcaagaacagctccttt
cagagcatgaaagaaaacaagatgtccaattattccctcctgagtgttgattatgtagtg
gacaaagcacaacttctgagaaaaggtgtatctggggactggaaaaatcacttcacagtg
gcccaagctgaagactttgataaattgttccaagagaagatggcagatcttcctcgagag
ctgttcccatgggaataa

DBGET integrated database retrieval system