KEGG   Homo sapiens (human): 6822Help
Entry
6822              CDS       T01001                                 

Gene name
SULT2A1, DHEA-ST, DHEAS, HST, ST2, ST2A1, ST2A3, STD, hSTa
Definition
sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (EC:2.8.2.14)
Orthology
K11822  
bile-salt sulfotransferase [EC:2.8.2.14]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolism of xenobiotics by cytochrome P450
Bile secretion
Chemical carcinogenesis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:hsa00980]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 285 aa AA seqDB search
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgatttcttatggtttgaaggcatagctttccctactatgggtttcagatcc
gaaaccttaagaaaagtacgtgatgagttcgtgataagggatgaagatgtaataatattg
acttaccccaaatcaggaacaaactggttggctgagattctctgcctgatgcactccaag
ggggatgccaagtggatccaatctgtgcccatctgggagcgatcaccctgggtagagagt
gagattgggtatacagcactcagtgaaacggagagtccacgtttattctcctcccacctc
cccatccagttattccccaagtctttcttcagttccaaggccaaggtgatttatctcatg
agaaatcccagagatgttttggtgtctggttattttttctggaaaaacatgaagtttatt
aagaaaccaaagtcatgggaagaatattttgaatggttttgtcaaggaactgtgctatat
gggtcatggtttgaccacattcatggctggatgcccatgagagaggagaaaaacttcctg
ttactgagttatgaggagctgaaacaggacacaggaagaaccatagagaagatctgtcaa
ttcctgggaaagacgttagaacccgaagaactgaacttaattctcaagaacagctccttt
cagagcatgaaagaaaacaagatgtccaattattccctcctgagtgttgattatgtagtg
gacaaagcacaacttctgagaaaaggtgtatctggggactggaaaaatcacttcacagtg
gcccaagctgaagactttgataaattgttccaagagaagatggcagatcttcctcgagag
ctgttcccatgggaataa

DBGET integrated database retrieval system