KEGG   Homo sapiens (human): 6833Help
Entry
6833              CDS       T01001                                 

Gene name
ABCC8, ABC36, HHF1, HI, HRINS, MRP8, PHHI, SUR, SUR1, SUR1delta2, TNDM2
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 8
Orthology
K05032  
ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Insulin secretion
Type II diabetes mellitus
Disease
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00513  
Transient neonatal diabetes mellitus (TNDM)
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Glibenclamide: 
Chlorpropamide: 
Tolbutamide: 
Glibornuride: 
Tolazamide: 
Carbutamide: 
Glipizide: 
Gliquidone: 
Gliclazide: 
Metahexamide: 
Glisoxepide: 
Glimepiride: 
Acetohexamide: 
Glymidine: 
Repaglinide: 
Nateglinide: 
Mitiglinide: 
Nicorandil: 
Diazoxide: 
Minoxidil: 
Pinacidil: 
Tolbutamide: 
Other: 
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.1
AA seq 1581 aa AA seqDB search
MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI
HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTS
VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDHAIGFSQLRFCLTGLLVILYG
MLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLV
LSSTFRILADLLGFAGPLCIFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAV
LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL
VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYT
SISIFMNTAIPIAAVLITFVGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRST
VKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQAVPLRVVNRKRPAREDCRGLT
GPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLN
ATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVA
RALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWII
AMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS
SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQL
LKHMVLVAIDYWLAKWTDSALTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLV
TSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTLE
CLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL
SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVL
IAAVTSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKT
EAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQKIGICGRT
GSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD
PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTS
IFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFD
KPEKLLSRKDSVFASFVRADK
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atgcccctggccttctgcggcagcgagaaccactcggccgcctaccgggtggaccagggg
gtcctcaacaacggctgctttgtggacgcgctcaacgtggtgccgcacgtcttcctactc
ttcatcaccttccccatcctcttcattggatggggaagtcagagctccaaggtgcacatc
caccacagcacatggcttcatttccctgggcacaacctgcggtggatcctgaccttcatg
ctgctcttcgtcctggtgtgtgagattgcagagggcatcctgtctgatggggtgaccgaa
tcccaccatctgcacctgtacatgccagccgggatggcgttcatggctgctgtcacctcc
gtggtctactatcacaacatcgagacttccaacttccccaagctgctaattgccctgctg
gtgtattggaccctggccttcatcaccaagaccatcaagtttgtcaagttcttggaccac
gccatcggcttctcgcagctacgcttctgcctcacagggctgctggtgatcctctatggg
atgctgctcctcgtggaggtcaatgtcatcagggtgaggagatacatcttcttcaagaca
ccgagggaggtgaagcctcccgaggacctgcaagacctgggggtacgcttcctgcagccc
ttcgtgaatctgctgtccaaaggcacctactggtggatgaacgccttcatcaagactgcc
cacaagaagcccatcgacttgcgagccatcgggaagctgcccatcgccatgagggccctc
accaactaccaacggctctgcgaggcctttgacgcccaggtgcggaaggacattcagggc
actcaaggtgcccgggccatctggcaggcactcagccatgccttcgggaggcgcctggtc
ctcagcagcactttccgcatcttggccgacctgctgggcttcgccgggccactgtgcatc
tttgggatcgtggaccaccttgggaaggagaacgacgtcttccagcccaagacacaattt
ctcggggtttactttgtctcatcccaagagttccttgccaatgcctacgtcttagctgtg
cttctgttccttgccctcctactgcaaaggacatttctgcaagcatcctactatgtggcc
attgaaactggaattaacttgagaggagcaatacagaccaagatttacaataaaattatg
cacctgtccacctccaacctgtccatgggagaaatgactgctggacagatctgtaatctg
gttgccatcgacaccaatcagctcatgtggtttttcttcttgtgcccaaacctctgggct
atgccagtacagatcattgtgggtgtgattctcctctactacatactcggagtcagtgcc
ttaattggagcagctgtcatcattctactggctcctgtccagtacttcgtggccaccaag
ctgtctcaggcccagcggagcacactggagtattccaatgagcggctgaagcagaccaac
gagatgctccgcggcatcaagctgctgaagctgtacgcctgggagaacatcttccgcacg
cgggtggagacgacccgcaggaaggagatgaccagcctcagggcctttgccatctatacc
tccatctccattttcatgaacacggccatccccattgcagctgtcctcataactttcgtg
ggccacgtcagcttcttcaaagaggccgacttctcgccctccgtggcctttgcctccctc
tccctcttccatatcttggtcacaccgctgttcctgctgtccagtgtggtccgatctacc
gtcaaagctctagtgagcgtgcaaaagctaagcgagttcctgtccagtgcagagatccgt
gaggagcagtgtgccccccatgagcccacacctcagggcccagccagcaagtaccaggcg
gtgcccctcagggttgtgaaccgcaagcgtccagcccgggaggattgtcggggcctcacc
ggcccactgcagagcctggtccccagtgcagatggcgatgctgacaactgctgtgtccag
atcatgggaggctacttcacgtggaccccagatggaatccccacactgtccaacatcacc
attcgtatcccccgaggccagctgactatgatcgtggggcaggtgggctgcggcaagtcc
tcgctccttctagccgcactgggggagatgcagaaggtctcaggggctgtcttctggagc
agccttcctgacagcgagataggagaggaccccagcccagagcgggagacagcgaccgac
ttggatatcaggaagagaggccccgtggcctatgcttcgcagaaaccatggctgctaaat
gccactgtggaggagaacatcatctttgagagtcccttcaacaaacaacggtacaagatg
gtcattgaagcctgctctctgcagccagacatcgacatcctgccccatggagaccagacc
cagattggggaacggggcatcaacctgtctggtggtcaacgccagcgaatcagtgtggcc
cgagccctctaccagcacgccaacgttgtcttcttggatgaccccttctcagctctggat
atccatctgagtgaccacttaatgcaggccggcatccttgagctgctccgggacgacaag
aggacagtggtcttagtgacccacaagctacagtacctgccccatgcagactggatcatt
gccatgaaggatggcaccatccagagggagggtaccctcaaggacttccagaggtctgaa
tgccagctctttgagcactggaagaccctcatgaaccgacaggaccaagagctggagaag
gagactgtcacagagagaaaagccacagagccaccccagggcctatctcgtgccatgtcc
tcgagggatggccttctgcaggatgaggaagaggaggaagaggaggcagctgagagcgag
gaggatgacaacctgtcgtccatgctgcaccagcgtgctgagatcccatggcgagcctgc
gccaagtacctgtcctccgccggcatcctgctcctgtcgttgctggtcttctcacagctg
ctcaagcacatggtcctggtggccatcgactactggctggccaagtggaccgacagcgcc
ctgaccctgacccctgcagccaggaactgctccctcagccaggagtgcaccctcgaccag
actgtctatgccatggtgttcacggtgctctgcagcctgggcattgtgctgtgcctcgtc
acgtctgtcactgtggagtggacagggctgaaggtggccaagagactgcaccgcagcctg
ctaaaccggatcatcctagcccccatgaggttttttgagaccacgccccttgggagcatc
ctgaacagattttcatctgactgtaacaccatcgaccagcacatcccatccacgctggag
tgcctgagccgctccaccctgctctgtgtctcagccctggccgtcatctcctatgtcaca
cctgtgttcctcgtggccctcttgcccctggccatcgtgtgctacttcatccagaagtac
ttccgggtggcgtccagggacctgcagcagctggatgacaccacccagcttccacttctc
tcacactttgccgaaaccgtagaaggactcaccaccatccgggccttcaggtatgaggcc
cggttccagcagaagcttctcgaatacacagactccaacaacattgcttccctcttcctc
acagctgccaacagatggctggaagtccgaatggagtacatcggtgcatgtgtggtgctc
atcgcagcggtgacctccatctccaactccctgcacagggagctctctgctggcctggtg
ggcctgggccttacctacgccctaatggtctccaactacctcaactggatggtgaggaac
ctggcagacatggagctccagctgggggctgtgaagcgcatccatgggctcctgaaaacc
gaggcagagagctacgaggggctcctggcaccatcgctgatcccaaagaactggccagac
caagggaagatccagatccagaacctgagcgtgcgctacgacagctccctgaagccggtg
ctgaagcacgtcaatgccctcatcgcccctggacagaagatcgggatctgcggccgcacc
ggcagtgggaagtcctccttctctcttgccttcttccgcatggtggacacgttcgaaggg
cacatcatcattgatggcattgacatcgccaaactgccgctgcacaccctgcgctcacgc
ctctccatcatcctgcaggaccccgtcctcttcagcggcaccatccgatttaacctggac
cctgagaggaagtgctcagatagcacactgtgggaggccctggaaatcgcccagctgaag
ctggtggtgaaggcactgccaggaggcctcgatgccatcatcacagaaggcggggagaat
ttcagccagggacagaggcagctgttctgcctggcccgggccttcgtgaggaagaccagc
atcttcatcatggacgaggccacggcttccattgacatggccacggaaaacatcctccaa
aaggtggtgatgacagccttcgcagaccgcactgtggtcaccatcgcgcatcgagtgcac
accatcctgagtgcagacctggtgatcgtcctgaagcggggtgccatccttgagttcgat
aagccagagaagctgctcagccggaaggacagcgtcttcgcctccttcgtccgtgcagac
aagtga

DBGET integrated database retrieval system