KEGG   Homo sapiens (human): 6839Help
Entry
6839              CDS       T01001                                 

Gene name
SUV39H1, H3-K9-HMTase_1, KMT1A, MG44, SUV39H
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    6839 (SUV39H1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     6839 (SUV39H1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     6839 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    6839 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagcgtgtgttgcaagtcttcttggaatcagctgcag
gacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaatattac
ctggtgaaatggcgtggatatccagactcagagagcacctgggagccacggcagaatctc
aagtgtgtgcgtatcctcaagcagttccacaaggacttagaaagggagctgctccggcgg
caccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccgtcgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcactgtagagaatgaggtggacctggacggccctccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgcccatctac
gagtgcaactcccgctgccgctgcggctatgactgcccaaatcgtgtggtacagaagggt
atccgatatgacctctgcatcttccgcacggatgatgggcgtggctggggcgtccgcacc
ctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcagagcggcggggccagatctacgaccgtcagggcgccacctacctctttgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagacaacctt
gacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtattgaatgc
aagtgtgggactgagtcctgccgcaaatacctcttctag

DBGET integrated database retrieval system