KEGG   Homo sapiens (human): 6839Help
Entry
6839              CDS       T01001                                 

Gene name
SUV39H1, H3-K9-HMTase_1, KMT1A, MG44, SUV39H
Definition
suppressor of variegation 3-9 homolog 1 (Drosophila) (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 423 aa AA seqDB search
MVGMSRLRNDRLADPLTGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLC
DYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRH
LDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVG
EGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCG
YDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQI
YDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAF
FATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRK
YLF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtggggatgagtcgcctgagaaatgacagactggctgacccactgacaggctgcagc
gtgtgttgcaagtcttcttggaatcagctgcaggacctgtgccgcctggccaagctctcc
tgccctgccctcggtatctctaagaggaacctctatgactttgaagtcgagtacctgtgc
gattacaagaagatccgcgaacaggaatattacctggtgaaatggcgtggatatccagac
tcagagagcacctgggagccacggcagaatctcaagtgtgtgcgtatcctcaagcagttc
cacaaggacttagaaagggagctgctccggcggcaccaccggtcaaagaccccccggcac
ctggacccaagcttggccaactacctggtgcagaaggccaagcagaggcgggcgctccgt
cgctgggagcaggagctcaatgccaagcgcagccatctgggacgcatcactgtagagaat
gaggtggacctggacggccctccgcgggccttcgtgtacatcaatgagtaccgtgttggt
gagggcatcaccctcaaccaggtggctgtgggctgcgagtgccaggactgtctgtgggca
cccactggaggctgctgcccgggggcgtcactgcacaagtttgcctacaatgaccagggc
caggtgcggcttcgagccgggctgcccatctacgagtgcaactcccgctgccgctgcggc
tatgactgcccaaatcgtgtggtacagaagggtatccgatatgacctctgcatcttccgc
acggatgatgggcgtggctggggcgtccgcaccctggagaagattcgcaagaacagcttc
gtcatggagtacgtgggagagatcattacctcagaggaggcagagcggcggggccagatc
tacgaccgtcagggcgccacctacctctttgacctggactacgtggaggacgtgtacacc
gtggatgccgcctactatggcaacatctcccactttgtcaaccacagttgtgaccccaac
ctgcaggtgtacaacgtcttcatagacaaccttgacgagcggctgccccgcatcgctttc
tttgccacaagaaccatccgggcaggcgaggagctcacctttgattacaacatgcaagtg
gaccccgtggacatggagagcacccgcatggactccaactttggcctggctgggctccct
ggctcccctaagaagcgggtccgtattgaatgcaagtgtgggactgagtcctgccgcaaa
tacctcttctag

DBGET integrated database retrieval system