KEGG   Homo sapiens (human): 6844Help
Entry
6844              CDS       T01001                                 

Gene name
VAMP2, SYB2, VAMP-2
Definition
vesicle-associated membrane protein 2 (synaptobrevin 2)
Orthology
K13504  
vesicle-associated membrane protein 2
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Insulin secretion
Vasopressin-regulated water reabsorption
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6844 (VAMP2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6844 (VAMP2)
  Digestive system
   04970 Salivary secretion
    6844 (VAMP2)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    6844 (VAMP2)
  Nervous system
   04721 Synaptic vesicle cycle
    6844 (VAMP2)
SNAREs [BR:hsa04131]
 VAMP, Ykt6, Sec22 (R)
  VAMP
   6844 (VAMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 116 aa AA seqDB search
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaccgctgccacggccccccctgctgccccggctggggagggtggtccccct
gcaccccctccaaacctcaccagtaacaggagactgcagcagacccaggcccaggtggat
gaggtggtggacatcatgagggtgaacgtggacaaggtcctggagcgagaccagaagctg
tcggagctggacgaccgtgcagatgcactccaggcgggggcctcccagtttgaaacaagc
gcagccaagctcaagcgcaaatactggtggaaaaacctcaagatgatgatcatcttggga
gtgatttgcgccatcatcctcatcatcatcatagtttacttcagcacttaa

DBGET integrated database retrieval system