KEGG   Homo sapiens (human): 6846Help
Entry
6846              CDS       T01001                                 

Gene name
XCL2, SCM-1b, SCM1B, SCYC2
Definition
(RefSeq) X-C motif chemokine ligand 2
  KO
K22675  C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6846 (XCL2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6846 (XCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6846 (XCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 PHtD_u1
Motif
Other DBs
NCBI-GeneID: 6846
NCBI-ProteinID: NP_003166
OMIM: 604828
HGNC: 10646
Ensembl: ENSG00000143185
Vega: OTTHUMG00000034549
Pharos: Q9UBD3(Tbio)
UniProt: Q9UBD3
Position
1q24.2
AA seq 114 aa AA seqDB search
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcacataggaggacctgtgtgagcctcactacccagcgactg
ccagttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacgtgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgaccctgactggctag

DBGET integrated database retrieval system