KEGG   Homo sapiens (human): 6846Help
Entry
6846              CDS       T01001                                 

Gene name
XCL2, SCM-1b, SCM1B, SCYC2
Definition
chemokine (C motif) ligand 2
Orthology
K05507  
C motif chemokine 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6846 (XCL2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6846 (XCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q24.2
AA seq 114 aa AA seqDB search
MRLLILALLGICSLTAYIVEGVGSEVSHRRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagacttctcatcctggccctccttggcatctgctctctcactgcatacattgtggaa
ggtgtagggagtgaagtctcacataggaggacctgtgtgagcctcactacccagcgactg
ccagttagcagaatcaagacctacaccatcacggaaggctccttgagagcagtaattttt
attaccaaacgtggcctaaaagtctgtgctgatccacaagccacgtgggtgagagacgtg
gtcaggagcatggacaggaaatccaacaccagaaataacatgatccagaccaagccaaca
ggaacccagcaatcgaccaatacagctgtgaccctgactggctag

DBGET integrated database retrieval system