KEGG   Homo sapiens (human): 6850Help
Entry
6850              CDS       T01001                                 

Gene name
SYK, p72-Syk
Definition
spleen tyrosine kinase (EC:2.7.10.2)
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Epstein-Barr virus infection
Viral carcinogenesis
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22
AA seq 612 aa AA seqDB search
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPASSPAQGNRQESTVSFNPY
EPELAPWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFG
TVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES
WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLV
TQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMW
EAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVE
LRLRNYYYDVVN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggtggcttcgccctgtccgtggcccacgggaggaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgccggtggcagg
acccatgccagccccgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaac
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgtcctcccctgcccaagggaaccggcaagagagtactgtgtcattcaatccgtat
gagccagaacttgcaccctgggctgcagacaaaggcccccagagagaagccctacccatg
gacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggcccaaggaggtt
tacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggtaattttgga
actgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggctgtgaaaata
ctgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaagcaaatgtc
atgcagcagctggacaacccgtacatcgtgcggatgatcgggatatgcgaggccgagtcc
tggatgctggttatggagatggcagaacttggtcccctcaataagtatttgcagcagaac
agacatgtcaaggataagaacatcatagaactggttcatcaggtttccatgggcatgaag
tacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtgttgctagtt
acccaacattacgccaagatcagtgatttcggactttccaaagcactgcgtgctgatgaa
aactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgctccggaatgc
atcaactactacaagttctccagcaaaagcgatgtctggagctttggagtgttgatgtgg
gaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaagtcaccgct
atgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagagatgtacgat
ctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgcagcagtggaa
ctgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system