KEGG   Homo sapiens (human): 6857Help
Entry
6857              CDS       T01001                                 

Gene name
SYT1, P65, SVP65, SYT
Definition
synaptotagmin I
Orthology
K15290  
synaptotagmin-1
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    6857 (SYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12cen-q21
AA seq 422 aa AA seqDB search
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA
LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK
DDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP
YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI
IGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVV
TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgagagtcaccatgaggccctggcagccccgcctgtcaccactgtcgcgact
gttctgccaagcaacgccacagagccagccagtcctggagaaggaaaggaagatgcattt
tctaagctgaaggagaagtttatgaatgagttgcataaaattccattgccaccgtgggcc
ttaattgcaatagccatagtcgcagtccttttagtcctgacctgctgcttttgtatctgt
aagaaatgtttgttcaaaaagaaaaacaagaagaagggaaaggaaaaaggagggaagaat
gccattaacatgaaagatgtaaaagacttagggaagacgatgaaagatcaggccctcaag
gatgatgatgctgaaactggattgacagatggagaagaaaaagaagaacccaaagaagag
gagaaactgggaaaacttcagtattcactggattatgatttccaaaataaccagctgctg
gtagggatcattcaggctgccgaactgcccgccttggacatggggggcacatctgatcct
tacgtgaaagtgtttctgctacctgataagaagaagaaatttgagacaaaagtccaccga
aaaacccttaatcctgtcttcaatgagcaatttactttcaaggtaccatactcggaattg
ggtggcaaaaccctagtgatggctgtatatgattttgatcgtttctctaagcatgacatc
attggagaatttaaagtccctatgaacacagtggattttggccatgtaactgaggaatgg
cgtgacctgcaaagtgctgagaaggaagagcaagagaaattgggtgatatctgcttctcc
cttcgctacgtacctactgctggtaagctgactgttgtcattctggaggcaaagaacctg
aagaagatggatgtgggtggcttatccgatccttatgtgaagattcatctgatgcagaat
ggtaagaggctgaagaagaaaaagacaacaattaaaaagaacacacttaacccctactac
aatgagtcattcagctttgaagtaccttttgaacaaatccagaaagtgcaggtggtggta
actgttttggactatgacaagattggcaagaacgatgccatcggcaaagtctttgtgggc
tacaacagcaccggcgcggagctgcgacactggtcagacatgctggccaaccccaggcga
cctattgcccagtggcacaccctgcaggtagaggaggaagttgatgccatgctggccgtc
aagaagtaa

DBGET integrated database retrieval system