KEGG   Homo sapiens (human): 6863Help
Entry
6863              CDS       T01001                                 

Gene name
TAC1, Hs.2563, NK2, NKNA, NPK, TAC2
Definition
tachykinin, precursor 1
Orthology
K05239  
tachykinin 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6863 (TAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q22
AA seq 129 aa AA seqDB search
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctcgtggccttggcagtcttttttcttgtctccactcagctgtttgcagaa
gaaataggagccaatgatgatctgaattactggtccgactggtacgacagcgaccagatc
aaggaggaactgccggagccctttgagcatcttctgcagagaatcgcccggagacccaag
cctcagcagttctttggattaatgggcaaacgggatgctgattcctcaattgaaaaacaa
gtggccctgttaaaggctctttatggacatggccagatctctcacaaaagacataaaaca
gattcctttgttggactaatgggcaaaagagctttaaattctgtggcttatgaaaggagt
gcaatgcagaattatgaaagaagacgttaa

DBGET integrated database retrieval system