KEGG   Homo sapiens (human): 6865Help
Entry
6865              CDS       T01001                                 

Gene name
TACR2, NK2R, NKNAR, SKR, TAC2R
Definition
tachykinin receptor 2
Orthology
K04223  
tachykinin receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6865 (TACR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6865 (TACR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Tachykinin [OT]
    6865 (TACR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 398 aa AA seqDB search
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggggacctgtgacattgtgactgaagccaatatctcatctggccctgagagcaacacc
acgggcatcacagccttctccatgcccagctggcaactggcactgtgggccacagcctac
ctggccctggtgctggtggccgtgacgggtaatgccatcgtcatctggatcatcctggcc
catcggaggatgcgcacagtcaccaactacttcatcgtcaatctggcgctggctgacctc
tgcatggctgccttcaatgccgccttcaactttgtctatgccagccacaacatctggtac
tttggccgtgccttctgctacttccagaacctcttccccatcacagccatgtttgtcagc
atctactccatgaccgccattgctgccgacaggtacatggccatcgtccaccccttccag
cctcggctttcagctcccagcaccaaggcggttattgctggcatctggctggtggctctc
gccctggcctcccctcagtgcttctactccaccgtcaccatggaccagggtgccaccaag
tgcgtggtggcctggcccgaagacagcgggggcaagacgctcctcctgtaccacctcgtg
gtgatcgccctcatctacttcctgccgctcgcggtgatgtttgtagcctacagcgtcatc
ggcctcacgctctggaggcgcgcagtgcccggacatcaggcgcacggtgccaacctgcgc
cacctgcaggccatgaagaagtttgtgaagaccatggtgctggtggtgctgacgtttgcc
atctgctggctgccctaccacctctacttcatcctgggcagcttccaggaggacatctac
tgccacaagttcatccagcaagtctacctggcactcttctggttggccatgagctctacc
atgtacaatcccatcatctactgctgtctcaaccacaggtttcgctctggattccggctt
gccttccgctgctgcccatgggtcacacccaccaaggaagataagctcgagctgactccc
acgacctccctctccacgagagtcaacaggtgtcacactaaggagactttgttcatggct
ggggacacagccccctccgaggctaccagtggggaggcggggcgtccccaggatggatca
gggctatggtttgggtatggtttgcttgcccccaccaaaactcatgttgaaatttga

DBGET integrated database retrieval system