KEGG   Homo sapiens (human): 6868Help
Entry
6868              CDS       T01001                                 

Gene name
ADAM17, ADAM18, CD156B, CSVP, NISBD, NISBD1, TACE
Definition
(RefSeq) ADAM metallopeptidase domain 17
  KO
K06059  disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05010  Alzheimer's disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hsa_M00682  Notch signaling
Drug target
Aderbasib: D09320
Apratastat: D08859
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    6868 (ADAM17)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6868 (ADAM17)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6868 (ADAM17)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     6868 (ADAM17)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   6868 (ADAM17)
CD molecules [BR:hsa04090]
 Proteins
  6868 (ADAM17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin_5 Reprolysin_2 ADAM17_MPD Disintegrin Reprolysin_3 Reprolysin Pep_M12B_propep Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 6868
NCBI-ProteinID: NP_003174
OMIM: 603639
HGNC: 195
Ensembl: ENSG00000151694
Vega: OTTHUMG00000090425
Pharos: P78536(Tchem)
UniProt: P78536 B2RNB2
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 824 aa AA seqDB search
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagtctctcctattcctgaccagcgtggttcctttcgtgctggcgccgcgacct
ccggatgacccgggcttcggcccccaccagagactcgagaagcttgattctttgctctca
gactacgatattctctctttatctaatatccagcagcattcggtaagaaaaagagatcta
cagacttcaacacatgtagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacctgacatcaagtactgaacgtttttcacaaaatttcaaggtcgtggtggtggat
ggtaaaaacgaaagcgagtacactgtaaaatggcaggacttcttcactggacacgtggtt
ggtgagcctgactctagggttctagcccacataagagatgatgatgttataatcagaatc
aacacagatggggccgaatataacatagagccactttggagatttgttaatgataccaaa
gacaaaagaatgttagtttataaatctgaagatatcaagaatgtttcacgtttgcagtct
ccaaaagtgtgtggttatttaaaagtggataatgaagagttgctcccaaaagggttagta
gacagagaaccacctgaagagcttgttcatcgagtgaaaagaagagctgacccagatccc
atgaagaacacgtgtaaattattggtggtagcagatcatcgcttctacagatacatgggc
agaggggaagagagtacaactacaaattacttaatagagctaattgacagagttgatgac
atctatcggaacacttcatgggataatgcaggttttaaaggctatggaatacagatagag
cagattcgcattctcaagtctccacaagaggtaaaacctggtgaaaagcactacaacatg
gcaaaaagttacccaaatgaagaaaaggatgcttgggatgtgaagatgttgctagagcaa
tttagctttgatatagctgaggaagcatctaaagtttgcttggcacaccttttcacatac
caagattttgatatgggaactcttggattagcttatgttggctctcccagagcaaacagc
catggaggtgtttgtccaaaggcttattatagcccagttgggaagaaaaatatctatttg
aatagtggtttgacgagcacaaagaattatggtaaaaccatccttacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgatccggatggtcta
gcagaatgtgccccgaatgaggaccagggagggaaatatgtcatgtatcccatagctgtg
agtggcgatcacgagaacaataagatgttttcaaactgcagtaaacaatcaatctataag
accattgaaagtaaggcccaggagtgttttcaagaacgcagcaataaagtttgtgggaac
tcgagggtggatgaaggagaagagtgtgatcctggcatcatgtatctgaacaacgacacc
tgctgcaacagcgactgcacgttgaaggaaggtgtccagtgcagtgacaggaacagtcct
tgctgtaaaaactgtcagtttgagactgcccagaagaagtgccaggaggcgattaatgct
acttgcaaaggcgtgtcctactgcacaggtaatagcagtgagtgcccgcctccaggaaat
gctgaagatgacactgtttgcttggatcttggcaagtgtaaggatgggaaatgcatccct
ttctgcgagagggaacagcagctggagtcctgtgcatgtaatgaaactgacaactcctgc
aaggtgtgctgcagggacctttctggccgctgtgtgccctatgtcgatgctgaacaaaag
aacttatttttgaggaaaggaaagccctgtacagtaggattttgtgacatgaatggcaaa
tgtgagaaacgagtacaggatgtaattgaacgattttgggatttcattgaccagctgagc
atcaatacttttggaaagtttttagcagacaacatcgttgggtctgtcctggttttctcc
ttgatattttggattcctttcagcattcttgtccattgtgtggataagaaattggataaa
cagtatgaatctctgtctctgtttcaccccagtaacgtcgaaatgctgagcagcatggat
tctgcatcggttcgcattatcaaaccctttcctgcgccccagactccaggccgcctgcag
cctgcccctgtgatcccttcggcgccagcagctccaaaactggaccaccagagaatggac
accatccaggaagaccccagcacagactcacatatggacgaggatgggtttgagaaggac
cccttcccaaatagcagcacagctgccaagtcatttgaggatctcacggaccatccggtc
accagaagtgaaaaggctgcctcctttaaactgcagcgtcagaatcgtgttgacagcaaa
gaaacagagtgctaa

DBGET integrated database retrieval system