KEGG   Homo sapiens (human): 6868Help
Entry
6868              CDS       T01001                                 

Gene name
ADAM17, ADAM18, CD156B, CSVP, NISBD, TACE
Definition
ADAM metallopeptidase domain 17 (EC:3.4.24.86)
Orthology
K06059  
disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Epithelial cell signaling in Helicobacter pylori infection
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25
AA seq 824 aa AA seqDB search
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagtctctcctattcctgaccagcgtggttcctttcgtgctggcgccgcgacct
ccggatgacccgggcttcggcccccaccagagactcgagaagcttgattctttgctctca
gactacgatattctctctttatctaatatccagcagcattcggtaagaaaaagagatcta
cagacttcaacacatgtagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacctgacatcaagtactgaacgtttttcacaaaatttcaaggtcgtggtggtggat
ggtaaaaacgaaagcgagtacactgtaaaatggcaggacttcttcactggacacgtggtt
ggtgagcctgactctagggttctagcccacataagagatgatgatgttataatcagaatc
aacacagatggggccgaatataacatagagccactttggagatttgttaatgataccaaa
gacaaaagaatgttagtttataaatctgaagatatcaagaatgtttcacgtttgcagtct
ccaaaagtgtgtggttatttaaaagtggataatgaagagttgctcccaaaagggttagta
gacagagaaccacctgaagagcttgttcatcgagtgaaaagaagagctgacccagatccc
atgaagaacacgtgtaaattattggtggtagcagatcatcgcttctacagatacatgggc
agaggggaagagagtacaactacaaattacttaatagagctaattgacagagttgatgac
atctatcggaacacttcatgggataatgcaggttttaaaggctatggaatacagatagag
cagattcgcattctcaagtctccacaagaggtaaaacctggtgaaaagcactacaacatg
gcaaaaagttacccaaatgaagaaaaggatgcttgggatgtgaagatgttgctagagcaa
tttagctttgatatagctgaggaagcatctaaagtttgcttggcacaccttttcacatac
caagattttgatatgggaactcttggattagcttatgttggctctcccagagcaaacagc
catggaggtgtttgtccaaaggcttattatagcccagttgggaagaaaaatatctatttg
aatagtggtttgacgagcacaaagaattatggtaaaaccatccttacaaaggaagctgac
ctggttacaactcatgaattgggacataattttggagcagaacatgatccggatggtcta
gcagaatgtgccccgaatgaggaccagggagggaaatatgtcatgtatcccatagctgtg
agtggcgatcacgagaacaataagatgttttcaaactgcagtaaacaatcaatctataag
accattgaaagtaaggcccaggagtgttttcaagaacgcagcaataaagtttgtgggaac
tcgagggtggatgaaggagaagagtgtgatcctggcatcatgtatctgaacaacgacacc
tgctgcaacagcgactgcacgttgaaggaaggtgtccagtgcagtgacaggaacagtcct
tgctgtaaaaactgtcagtttgagactgcccagaagaagtgccaggaggcgattaatgct
acttgcaaaggcgtgtcctactgcacaggtaatagcagtgagtgcccgcctccaggaaat
gctgaagatgacactgtttgcttggatcttggcaagtgtaaggatgggaaatgcatccct
ttctgcgagagggaacagcagctggagtcctgtgcatgtaatgaaactgacaactcctgc
aaggtgtgctgcagggacctttctggccgctgtgtgccctatgtcgatgctgaacaaaag
aacttatttttgaggaaaggaaagccctgtacagtaggattttgtgacatgaatggcaaa
tgtgagaaacgagtacaggatgtaattgaacgattttgggatttcattgaccagctgagc
atcaatacttttggaaagtttttagcagacaacatcgttgggtctgtcctggttttctcc
ttgatattttggattcctttcagcattcttgtccattgtgtggataagaaattggataaa
cagtatgaatctctgtctctgtttcaccccagtaacgtcgaaatgctgagcagcatggat
tctgcatcggttcgcattatcaaaccctttcctgcgccccagactccaggccgcctgcag
cctgcccctgtgatcccttcggcgccagcagctccaaaactggaccaccagagaatggac
accatccaggaagaccccagcacagactcacatatggacgaggatgggtttgagaaggac
cccttcccaaatagcagcacagctgccaagtcatttgaggatctcacggaccatccggtc
accagaagtgaaaaggctgcctcctttaaactgcagcgtcagaatcgtgttgacagcaaa
gaaacagagtgctaa

DBGET integrated database retrieval system