KEGG   Homo sapiens (human): 6869Help
Entry
6869              CDS       T01001                                 

Gene name
TACR1, NK1R, NKIR, SPR, TAC1R
Definition
tachykinin receptor 1
Orthology
K04222  
tachykinin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Measles
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6869 (TACR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6869 (TACR1)
 Human Diseases
  Infectious diseases
   05162 Measles
    6869 (TACR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Tachykinin [OT]
    6869 (TACR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p12
AA seq 407 aa AA seqDB search
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtcctcccggtggactcagacctctccccaaacatctccactaacacctcg
gaacccaatcagttcgtgcaaccagcctggcaaattgtcctttgggcagctgcctacacg
gtcattgtggtgacctctgtggtgggcaacgtggtagtgatgtggatcatcttagcccac
aaaagaatgaggacagtgacgaactattttctggtgaacctggccttcgcggaggcctcc
atggctgcattcaatacagtggtgaacttcacctatgctgtccacaacgaatggtactac
ggcctgttctactgcaagttccacaacttctttcccatcgccgctgtcttcgccagtatc
tactccatgacggctgtggcctttgataggtacatggccatcatacatcccctccagccc
cggctgtcagccacagccaccaaagtggtcatctgtgtcatctgggtcctggctctcctg
ctggccttcccccagggctactactcaaccacagagaccatgcccagcagagtcgtgtgc
atgatcgaatggccagagcatccgaacaagatttatgagaaagtgtaccacatctgtgtg
actgtgctgatctacttcctccccctgctggtgattggctatgcatacaccgtagtggga
atcacactatgggccagtgagatccccggggactcctctgaccgctaccacgagcaagtc
tctgccaagcgcaaggtggtcaaaatgatgattgtcgtggtgtgcaccttcgccatctgc
tggctgcccttccacatcttcttcctcctgccctacatcaacccagatctctacctgaag
aagtttatccagcaggtctacctggccatcatgtggctggccatgagctccaccatgtac
aaccccatcatctactgctgcctcaatgacaggttccgtctgggcttcaagcatgccttc
cggtgctgccccttcatcagcgccggcgactatgaggggctggaaatgaaatccacccgg
tatctccagacccagggcagtgtgtacaaagtcagccgcctggagaccaccatctccaca
gtggtgggggcccacgaggaggagccagaggacggccccaaggccacaccctcgtccctg
gacctgacctccaactgctcttcacgaagtgactccaagaccatgacagagagcttcagc
ttctcctccaatgtgctctcctag

DBGET integrated database retrieval system