KEGG   Homo sapiens (human): 6870Help
Entry
6870              CDS       T01001                                 

Gene name
TACR3, HH11, NK-3R, NK3R, NKR, TAC3RL
Definition
tachykinin receptor 3
Orthology
K04224  
tachykinin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Disease
H00255  
Hypogonadotropic hypogonadism
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6870 (TACR3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6870 (TACR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Tachykinin [OT]
    6870 (TACR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
4q25
AA seq 465 aa AA seqDB search
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccactctcccagcagcagaaacctggatagacgggggtggaggcgtgggtgcagac
gccgtgaacctgaccgcctcgctagctgccggggcggccacgggggcagttgagactggg
tggctgcaactgctggaccaagctggcaacctctcctcctccccttccgcgctgggactg
cctgtggcttcccccgcgccctcccagccctgggccaacctcaccaaccagttcgtgcag
ccgtcctggcgcatcgcgctctggtccctggcgtatggtgtggtggtggcagtggcagtt
ttgggaaatctcatcgtcatctggatcatcctggcccacaagcgcatgaggactgtcacc
aactacttccttgtgaacctggctttctccgacgcctccatggccgccttcaacacgttg
gtcaatttcatctacgcgcttcatagcgagtggtactttggcgccaactactgccgcttc
cagaacttctttcctatcacagctgtgttcgccagcatctactccatgacggccattgcg
gtggacaggtatatggctattattgatcccttgaaacccagactgtctgctacagcaacc
aagattgtcattggaagtatttggattctagcatttctacttgccttccctcagtgtctt
tattccaaaaccaaagtcatgccaggccgtactctctgctttgtgcaatggccagaaggt
cccaaacaacatttcacttaccatattatcgtcattatactggtgtactgtttcccattg
ctcatcatgggtattacatacaccattgttggaattactctctggggaggagaaatccca
ggagatacctgtgacaagtatcatgagcagctaaaggccaaaagaaaggttgtcaaaatg
atgattattgttgtcatgacatttgctatctgctggctgccctatcatatttacttcatt
ctcactgcaatctatcaacaactaaatagatggaaatacatccagcaggtctacctggct
agcttttggctggcaatgagctcaaccatgtacaatcccatcatctactgctgtctgaat
aaaagatttcgagctggcttcaagagagcatttcgctggtgtcctttcatcaaagtttcc
agctatgatgagctagagctcaagaccaccaggtttcatccaaaccggcaaagcagtatg
tacaccgtgaccagaatggagtccatgacagtcgtgtttgaccccaacgatgcagacacc
accaggtccagtcggaagaaaagagcaacgccaagagacccaagtttcaatggctgctct
cgcaggaattccaaatctgcctccgccacttcaagtttcataagctcaccctatacctct
gtggatgaatattcttaa

DBGET integrated database retrieval system