KEGG   Homo sapiens (human): 6875Help
Entry
6875              CDS       T01001                                 

Gene name
TAF4B, TAF2C2, TAFII105
Definition
TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
Orthology
K03129  
transcription initiation factor TFIID subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Huntington's disease
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6875 (TAF4B)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    6875 (TAF4B)
  Infectious diseases
   05168 Herpes simplex infection
    6875 (TAF4B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6875 (TAF4B)
   Coactivators
    SAGA/TFTC/STAGA complex
     6875 (TAF4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
18q11.2
AA seq 862 aa AA seqDB search
MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQ
PLRSPVGTLVTKVAPVSAPPKVSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIK
SNSGPLMLVSPQQTVTRAETTSNITSRPAVPANPQTVKICTVPNSSSQLIKKVAVTPVKK
LAQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLK
AENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTT
VTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAA
TGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVTLSLPAVTFGETSGAAIC
LPSVKPVVSSAGTTSDKPVIGTPVQIKLAQPGPVLSQPAGIPQAVQVKQLVVQQPSGGNE
KQVTTISHSSTLTIQKCGQKTMPVNTIIPTSQFPPASILKQITLPGNKILSLQASPTQKN
RIKENVTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLIQSCKDEPFLFIGAL
QKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLTAIAQHRMTTYKASENYILCS
DTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQLHRPRITRICLRDL
IFCMEQEREMKYSRALYLALLK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccggcctcaccgaacccgccggcgccgctcccccggctgctgtgagcgcctcg
gggaccgtgaccatggccccggccggggcgctgccggtgcgggtggagagcactccggtg
gccctgggcgccgtgactaaggctcctgtcagcgtctgcgtggagcccacggcgtcccag
cccctgcggtcccccgtggggaccctggtgaccaaagtggctccggtcagcgcccctcct
aaagtcagcagcggccctaggctgcctgctcctcagatagtcgccgtgaaagcccccaac
accacgacaatccagtttcctgctaatttgcagcttcctccaggaaccgttttgattaaa
agtaacagtggtccgttgatgttggtatctcctcagcaaactgtaacaagagccgagacc
acaagtaacataacctcaaggccagcagtaccagcgaatcctcaaacagtcaaaatctgt
acagtgccgaactctagctcacaattaatcaagaaagtggcagtgacacctgttaaaaaa
ttggcacaaataggaactactgtggtaaccactgttccgaagccttcctcagtacaatct
gtggctgtgccaaccagtgtcgtcacagttactcctggaaagccattgaatactgtaact
accctgaagccttcaagtttgggagcatcatccactccttcaaatgagcccaatcttaaa
gcagagaactcagcagctgttcagattaatctttctccgacaatgctagaaaatgtgaag
aaatgcaagaacttccttgcaatgttaataaaactagcatgtagtggatcacagtcccca
gaaatggggcaaaatgtgaagaagctggtggaacaacttttggatgcaaaaatcgaagca
gaagaatttactaggaaactgtatgttgaactcaagtcttcacctcagcctcacctggtt
ccttttcttaagaaaagcgtggttgccttacgacaacttctgcctaactcccagagcttc
atccagcaatgtgttcagcagacttctagtgacatggtcattgctacctgtactacaaca
gtaacaacttctcctgtggtgacaactacagtgtcctcaagccagtctgaaaagtcaatt
attgtttctggagcaacagcacccagaactgtgtcagtgcaaactttgaacccacttgct
ggtccagtgggagcaaaagctggagttgtgacacttcattctgtgggcccaactgctgca
acaggaggaacaacagctggaactggtttgcttcagacttcaaaaccacttgtgacatct
gtggcaaacacagtgaccacggtctcactgcaacctgaaaagccagttgtctctggaaca
gcagtaacactgtcccttccagcagtaacttttggagaaacttcaggtgcagctatttgt
cttccatctgtgaaacctgttgtttcttctgctgggaccacatctgacaagcctgttatt
gggactccagttcaaatcaaacttgcccagccgggccctgtcctttcacaaccagctggg
attccacaggcagttcaagtcaagcaactagtagttcagcagccttcaggaggcaatgaa
aaacaagtgaccacaatttcacattcctcaacattgaccattcagaaatgtggacagaag
acgatgccagtgaacaccataatacctactagtcagtttcctccagcttccattctaaag
caaattactctgcctggaaataaaattctgtcacttcaagcatctcctactcagaaaaat
agaataaaagagaatgtaacatcatgcttccgagatgaggatgacatcaatgatgtgact
tctatggcaggggtcaaccttaatgaagaaaatgcctgcatcttagcaacaaactctgaa
ttggttggcacactcattcagtcatgtaaagatgaaccatttctttttattggagctcta
caaaagagaattttagacattggtaaaaagcatgacattacagaacttaactctgatgct
gtgaacttgatctcccaagcaacacaggaacgactacgaggccttctagaaaaactgact
gcaattgctcagcatcgaatgactacttacaaggcaagtgaaaattacatcctgtgtagt
gataccaggtcacagctcaaatttcttgaaaagctggatcaattggagaagcagagaaag
gatttggaagaaagagaaatgttacttaaggcagccaagagtcgttctaataaagaagat
ccagaacagctgagattaaagcagaaagccaaagagttacagcaattggaacttgcacag
atacagcatagagacgctaatctcacagctcttgcagctattggaccaaggaagaagaga
ccactagaatctggaattgagggcttaaaagacaaccttcttgcttctgggacatccagc
ctgacagccaccaaacagttgcatcgtccaagaatcacgagaatctgcctcagggacttg
atattttgtatggaacaggaacgggagatgaagtattctcgagctctatacctggccctt
ctgaagtga

DBGET integrated database retrieval system