KEGG   Homo sapiens (human): 6879Help
Entry
6879              CDS       T01001                                 

Gene name
TAF7, TAF2F, TAFII55
Definition
TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Orthology
K03132  
transcription initiation factor TFIID subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 349 aa AA seqDB search
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR
VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK
KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagcaaagatgatgctcctcacgaactggagagccagtttatcttacgtctg
cctccagaatatgcctctactgtgagaagggcagtacagtctggtcatgtcaacctcaag
gacagactgacaattgagttacatcctgatgggcgtcatggaatcgtcagagtggaccgt
gttccattggcctcaaaattagtagacctgccctgtgttatggaaagcttgaaaaccatt
gataaaaaaactttttacaagacagctgatatctgtcagatgcttgtatccacagttgat
ggtgatctctatcctcctgtggaggagccagttgctagcactgatcctaaagcaagcaag
aaaaaggataaggacaaagagaaaaagtttatctggaaccacggaattactctgcctcta
aagaatgtcaggaagagaaggttccggaagacagcaaagaagaaatatattgaatctcca
gatgttgaaaaagaagtgaaacgattgctgagtacagatgctgaagctgttagtactcgg
tgggaaataattgccgaagatgaaacaaaggaggcagaaaatcaaggcctggatatctct
tctccaggaatgtctggtcacaggcagggccatgactcattagaacatgatgagcttcgg
gagatattcaatgacctcagcagcagcagtgaggatgaagatgagacccagcatcaagat
gaagaagatataaacatcattgacacggaggaagatctggagagacagctacaggacaag
ctaaatgaatcagatgaacagcaccaggaaaatgaaggaaccaatcagctggttatggga
attcagaagcagattgacaacatgaaaggcaagctccaagagacccaggacagggcaaaa
cgacaagaggatctcatcatgaaagtggaaaatctggctctcaagaacagatttcaggct
gtactggatgagctcaaacaaaaggaagaccgagaaaaggagcaactcagctctttgcaa
gaggagctagaatcactcctagagaagtaa

DBGET integrated database retrieval system