KEGG   Homo sapiens (human): 6882Help
Entry
6882              CDS       T01001                                 

Gene name
TAF11, MGC:15243, TAF2I, TAFII28
Definition
TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa
Orthology
K03135  
transcription initiation factor TFIID subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    6882 (TAF11)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6882 (TAF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 154 aa AA seqDB search
MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELES
QDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNR
YEMYRRSAFPKAAIKRHWMCVRSGEKCHHYNPNI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggacgatgcccacgagtcgccctccgacaaaggtggagagacaggggagtcggatgag
acggccgctgtgcccggggacccgggggctaccgacaccgatggaatcccagaggaaact
gacggagacgcagatgtggacttgaaagaagctgcagcggaggaaggcgagctcgagagt
caggatgtctcagatttaacaacagttgaaagggaagactcatcattacttaatcctgca
gccaaaaaactgaaaatagataccaaagaaaagaaagagaaaaagcagaaagtagatgaa
gatgagattcagaagatgcaaatcctggtttcttctttttctgaggagcagctgaaccgt
tatgaaatgtatcgccgctcagctttccctaaggcagccatcaaaaggcactggatgtgt
gtgagaagtggggagaaatgccaccactacaacccaaacatatga

DBGET integrated database retrieval system