KEGG   Homo sapiens (human): 6885Help
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, MEKK7, TAK1, TGF1a
Definition
mitogen-activated protein kinase kinase kinase 7 (EC:2.7.11.25)
Orthology
K04427  
mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
AMPK signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Adherens junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Measles
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6885 (MAP3K7)
   04310 Wnt signaling pathway
    6885 (MAP3K7)
   04064 NF-kappa B signaling pathway
    6885 (MAP3K7)
   04668 TNF signaling pathway
    6885 (MAP3K7)
   04152 AMPK signaling pathway
    6885 (MAP3K7)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    6885 (MAP3K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    6885 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    6885 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    6885 (MAP3K7)
   04660 T cell receptor signaling pathway
    6885 (MAP3K7)
  Development
   04380 Osteoclast differentiation
    6885 (MAP3K7)
 Human Diseases
  Infectious diseases
   05162 Measles
    6885 (MAP3K7)
   05168 Herpes simplex infection
    6885 (MAP3K7)
   05169 Epstein-Barr virus infection
    6885 (MAP3K7)
   05145 Toxoplasmosis
    6885 (MAP3K7)
   05140 Leishmaniasis
    6885 (MAP3K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     6885 (MAP3K7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   6885 (MAP3K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q15
AA seq 579 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacaggcaacggacagccaagacgtagatccatccaagacttgactgtaactgga
acagaacctggtcaggtgagcagtaggtcatccagtcccagtgtcagaatgattactacc
tcaggaccaacctcagaaaagccaactcgaagtcatccatggacccctgatgattccaca
gataccaatggatcagataactccatcccaatggcttatcttacactggatcaccaacta
cagcctctagcaccgtgcccaaactccaaagaatctatggcagtgtttgaacagcattgt
aaaatggcacaagaatatatgaaagttcaaacagaaattgcattgttattacagagaaag
caagaactagttgcagaactggaccaggatgaaaaggaccagcaaaatacatctcgcctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttctacttactaccagcaa
tgcaaaaaacaactagaggtcatcagaagtcagcagcagaaacgacaaggcacttcatga

DBGET integrated database retrieval system