KEGG   Homo sapiens (human): 6885Help
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, MEKK7, TAK1, TGF1a
Definition
mitogen-activated protein kinase kinase kinase 7 (EC:2.7.11.25)
Orthology
K04427  
mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Adherens junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Measles
Herpes simplex infection
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q15
AA seq 579 aa AA seqDB search
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacaggcaacggacagccaagacgtagatccatccaagacttgactgtaactgga
acagaacctggtcaggtgagcagtaggtcatccagtcccagtgtcagaatgattactacc
tcaggaccaacctcagaaaagccaactcgaagtcatccatggacccctgatgattccaca
gataccaatggatcagataactccatcccaatggcttatcttacactggatcaccaacta
cagcctctagcaccgtgcccaaactccaaagaatctatggcagtgtttgaacagcattgt
aaaatggcacaagaatatatgaaagttcaaacagaaattgcattgttattacagagaaag
caagaactagttgcagaactggaccaggatgaaaaggaccagcaaaatacatctcgcctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttctacttactaccagcaa
tgcaaaaaacaactagaggtcatcagaagtcagcagcagaaacgacaaggcacttcatga

DBGET integrated database retrieval system