KEGG   Homo sapiens (human): 6891Help
Entry
6891              CDS       T01001                                 

Gene name
TAP2, ABC18, ABCB3, APT2, D6S217E, PSF-2, PSF2, RING11
Definition
transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Orthology
K05654  
ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Phagosome
Antigen processing and presentation
Herpes simplex infection
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00984  
Bare lymphocyte syndrome (BLS) type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    6891 (TAP2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    6891 (TAP2)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    6891 (TAP2)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    6891 (TAP2)
  Infectious diseases
   05168 Herpes simplex infection
    6891 (TAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 703 aa AA seqDB search
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLG
FVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLS
PPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL
GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM
PFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE
QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV
GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIA
HRLQAVQRAHQILVLQEGKLQKLAQLQEGQDLYSRLVQQRLMD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccctgacctgagaccctggacctccctgctgctggtggacgcggctttactg
tggctgcttcagggccctctggggactttgcttcctcaagggctgccaggactatggctg
gaggggaccctgcggctgggagggctgtgggggctgctaaagctaagagggctgctggga
tttgtggggacactgctgctcccgctctgtctggccacccccctgactgtctccctgaga
gccctggtcgcgggggcctcacgtgctcccccagccagagtcgcttcagccccttggagc
tggctgctggtggggtacggggctgcggggctcagctggtcactgtgggctgttctgagc
cctcctggagcccaggagaaggagcaggaccaggtgaacaacaaagtcttgatgtggagg
ctgctgaagctctccaggccggacctgcctctcctcgttgccgccttcttcttccttgtc
cttgctgttttgggtgagacattaatccctcactattctggtcgtgtgattgacatcctg
ggaggtgattttgacccccatgcctttgccagtgccatcttcttcatgtgcctcttctcc
tttggcagctcactgtctgcaggctgccgaggaggctgcttcacctacaccatgtctcga
atcaacttgcggatccgggagcagcttttctcctccctgctgcgccaggacctcggtttc
ttccaggagactaagacaggggagctgaactcacggctgagctcggataccaccctgatg
agtaactggcttcctttaaatgccaatgtgctcttgcgaagcctggtgaaagtggtgggg
ctgtatggcttcatgctcagcatatcgcctcgactcaccctcctttctctgctgcacatg
cccttcacaatagcagcggagaaggtgtacaacacccgccatcaggaagtgcttcgggag
atccaggatgcagtggccagggcggggcaggtggtgcgggaagccgttggagggctgcag
accgttcgcagttttggggccgaggagcatgaagtctgtcgctataaagaggcccttgaa
caatgtcggcagctgtattggcggagagacctggaacgcgccttgtacctgctcgtaagg
agggtgctgcacttgggggtgcagatgctgatgctgagctgtgggctgcagcagatgcag
gatggggagctcacccagggcagcctgctttcctttatgatctaccaggagagcgtgggg
agctatgtgcagaccctggtatacatatatggggatatgctcagcaacgtgggagctgca
gagaaggttttctcctacatggaccgacagccaaatctgccttcacctggcacgcttgcc
cccaccactctgcagggggttgtgaaattccaagacgtctcctttgcatatcccaatcgc
cctgacaggcctgtgctcaaggggctgacgtttaccctacgtcctggtgaggtgacggcg
ctggtgggacccaatgggtctgggaagagcacagtggctgccctgctgcagaatctgtac
cagcccacagggggacaggtgctgctggatgaaaagcccatctcacagtatgaacactgc
tacctgcacagccaggtggtttcagttgggcaggagcctgtgctgttctccggttctgtg
aggaacaacattgcttatgggctgcagagctgcgaagatgataaggtgatggcggctgcc
caggctgcccacgcagatgacttcatccaggaaatggagcatggaatatacacagatgta
ggggagaagggaagccagctggctgcgggacagaaacaacgtctggccattgcccgggcc
cttgtacgagacccgcgggtcctcatcctggatgaggctactagtgccctagatgtgcag
tgcgagcaggccctgcaggactggaattcccgtggggatcgcacagtgctggtgattgct
cacaggctgcaggcagttcagcgcgcccaccagatcctggtgctccaggagggcaagctg
cagaagcttgcccagctccaggagggacaggacctctattcccgcctggttcagcagcgg
ctgatggactga

DBGET integrated database retrieval system