KEGG   Homo sapiens (human): 6895Help
Entry
6895              CDS       T01001                                 

Gene name
TARBP2, LOQS, TRBP, TRBP1, TRBP2
Definition
(RefSeq) TARBP2, RISC loading complex RNA binding subunit
  KO
K18420  RISC-loading complex subunit TARBP2
Organism
hsa  Homo sapiens (human)
Brite
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    RISC loading complex
     6895 (TARBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm DND1_DSRM Staufen_C
Motif
Other DBs
NCBI-GeneID: 6895
NCBI-ProteinID: NP_599150
OMIM: 605053
HGNC: 11569
Ensembl: ENSG00000139546
Vega: OTTHUMG00000169855
Pharos: Q15633(Tbio)
UniProt: Q15633
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 366 aa AA seqDB search
MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPE
DIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTV
TQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP
DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLK
IMAGSK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaggagcaaggctccggcactaccacgggctgcgggctgcctagtatagag
caaatgctggccgccaacccaggcaagaccccgatcagccttctgcaggagtatgggacc
agaatagggaagacgcctgtgtacgaccttctcaaagccgagggccaagcccaccagcct
aatttcaccttccgggtcaccgttggcgacaccagctgcactggtcagggccccagcaag
aaggcagccaagcacaaggcagctgaggtggccctcaaacacctcaaaggggggagcatg
ctggagccggccctggaggacagcagttctttttctcccctagactcttcactgcctgag
gacattccggtttttactgctgcagcagctgctaccccagttccatctgtagtcctaacc
aggagcccccccatggaactgcagccccctgtctcccctcagcagtctgagtgcaacccc
gttggtgctctgcaggagctggtggtgcagaaaggctggcggttgccggagtacacagtg
acccaggagtctgggccagcccaccgcaaagaattcaccatgacctgtcgagtggagcgt
ttcattgagattgggagtggcacttccaaaaaattggcaaagcggaatgcggcggccaaa
atgctgcttcgagtgcacacggtgcctctggatgcccgggatggcaatgaggtggagcct
gatgatgaccacttctccattggtgtgggctcccgcctggatggtcttcgaaaccggggc
ccaggttgcacctgggattctctacgaaattcagtaggagagaagatcctgtccctccgc
agttgctccctgggctccctgggtgccctgggccctgcctgctgccgtgtcctcagtgag
ctctctgaggagcaggcctttcacgtcagctacctggatattgaggagctgagcctgagt
ggactctgccagtgcctggtggaactgtccacccagccggccactgtgtgtcatggctct
gcaaccaccagggaggcagcccgtggtgaggctgcccgccgtgccctgcagtacctcaag
atcatggcaggcagcaagtga

DBGET integrated database retrieval system