KEGG   Homo sapiens (human): 6897Help
Entry
6897              CDS       T01001                                 

Gene name
TARS, ThrRS
Definition
threonyl-tRNA synthetase (EC:6.1.1.3)
Orthology
K01868  
threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    6897 (TARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     6897 (TARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   6897 (TARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    6897 (TARS)
 Prokaryotic Type
    6897 (TARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p13.2
AA seq 723 aa AA seqDB search
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFI
RSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAE
EEF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggagaaggccagcagtccttcagggaagatgggaggcgaggagaagccgatt
ggtgctggtgaagagaagcaaaaggaaggaggcaaaaagaagaacaaagaaggatctgga
gatggaggtcgagctgagttgaatccttggcctgaatatatttacacacgtcttgagatg
tataatatactaaaagcagaacatgattccattctggcagaaaaggcagaaaaagatagc
aagccaattaaagtcactttgcctgatggtaaacaggttgatgcggaatcttggaaaact
acaccatatcaaattgcctgtggaattagtcaaggcctggccgacaacaccgttattgct
aaagtaaataatgttgtgtgggacctggaccgccctctggaagaagattgtaccttggag
cttctcaagtttgaggatgaggaagctcaggcagtgtattggcactctagtgctcacata
atgggtgaagccatggaaagagtctatggtggatgtttatgctacggtccgccaatagaa
aatggattctattatgacatgtacctcgaagaagggggtgtgtctagcaatgatttctct
tctctggaggctttgtgtaagaaaatcattaaagaaaaacaagcttttgaaagactggaa
gttaagaaagaaactttactggcaatgtttaagtacaacaagttcaaatgccggatattg
aatgaaaaggtgaatactccaactaccacagtctatagatgtggccctttgatagatctc
tgccggggtcctcatgttagacacacgggcaaaattaaggctttaaaaatacacaaaaat
tcctccacgtactgggaaggcaaagcagatatggagactctccagagaatttatggcatt
tcattcccagatcctaaaatgttgaaagagtgggagaagttccaagaggaagctaaaaac
cgagatcataggaaaattggcagggaccaagaactatatttctttcatgaactcagccct
ggaagttgcttttttctgccaaaaggagcctacatttataatgcacttattgaattcatt
aggagcgaatataggaaaagaggattccaggaggtagtcaccccaaacatcttcaacagc
cgactctggatgacctcgggccactggcagcactacagcgagaacatgttctcctttgag
gtggagaaggagctgtttgccctgaaacccatgaactgcccaggacactgccttatgttt
gatcatcggccaaggtcctggcgagaactgcctctgcggctagctgattttggggtactt
cataggaacgagctgtctggagcactcacaggactcacccgggtacgaagattccaacag
gatgatgctcacatattctgtgccatggagcagattgaagatgaaataaaaggttgtttg
gattttctacgtacggtatatagcgtatttggattttcttttaaactaaacctttctact
cgcccggaaaaattccttggagatatcgaagtatgggatcaagctgagaaacaacttgaa
aacagtctgaatgaatttggtgaaaagtgggagttaaactctggagatggagctttctat
ggcccaaagattgacatacagattaaagatgcgattgggcggtaccaccagtgtgcaacc
atccagctggatttccagttgcccatcagatttaatcttacttatgtaagccatgatggt
gatgataagaaaaggccagtgattgttcatcgagccatcttgggatcagtggaaagaatg
attgctatcctcacagaaaactatgggggcaaatggcccttttggctgtcccctcgccag
gtaatggtagttccagtgggaccaacctgtgatgaatatgcccaaaaggtacgacaacaa
ttccacgatgccaaattcatggcagacattgatctggatccaggctgtacattgaataaa
aagattcgaaatgcacagttagcacagtataacttcattttagttgttggtgaaaaagag
aaaatcagtggcactgttaatatccgcacaagagacaataaggtccacggggaacgcacc
atttctgaaactatcgagcggctacagcagctcaaagagttccgcagcaaacaggcagaa
gaagaattttaa

DBGET integrated database retrieval system