KEGG   Homo sapiens (human): 6915Help
Entry
6915              CDS       T01001                                 

Gene name
TBXA2R, BDPLT13, TXA2-R
Definition
thromboxane A2 receptor
Orthology
K04264  
thromboxane A2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Platelet activation
Disease
H01235  
Bleeding disorder platelet-type
Drug target
Picotamide: 
Seratrodast: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6915 (TBXA2R)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6915 (TBXA2R)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6915 (TBXA2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Thromboxane
    6915 (TBXA2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 343 aa AA seqDB search
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccaacggcagttccctggggccctgtttccggcccacaaacattaccctggag
gagagacggctgatcgcctcgccctggttcgccgcctccttctgcgtggtgggcctggcc
tccaacctgctggccctgagcgtgctggcgggcgcgcggcaggggggttcgcacacgcgc
tcctccttcctcaccttcctctgcggcctcgtcctcaccgacttcctggggctgctggtg
accggtaccatcgtggtgtcccagcacgccgcgctcttcgagtggcacgccgtggaccct
ggctgccgtctctgtcgcttcatgggcgtcgtcatgatcttcttcggcctgtccccgctg
ctgctgggggccgccatggcctcagagcgctacctgggtatcacccggcccttctcgcgc
ccggcggtcgcctcgcagcgccgcgcctgggccaccgtggggctggtgtgggcggccgcg
ctggcgctgggcctgctgcccctgctgggcgtgggtcgctacaccgtgcaatacccgggg
tcctggtgcttcctgacgctgggcgccgagtccggggacgtggccttcgggctgctcttc
tccatgctgggcggcctctcggtcgggctgtccttcctgctgaacacggtcagcgtggcc
accctgtgccacgtctaccacgggcaggaggcggcccagcagcgtccccgggactccgag
gtggagatgatggctcagctcctggggatcatggtggtggccagcgtgtgttggctgccc
cttctggtcttcatcgcccagacagtgctgcgaaacccgcctgccatgagccccgccggg
cagctgtcccgcaccacggagaaggagctgctcatctacttgcgcgtggccacctggaac
cagatcctggacccctgggtgtatatcctgttccgccgcgccgtgctccggcgtctccag
cctcgcctcagcacccggcccaggtcgctgtccctccagccccagctcacgcagcgctcc
gggctgcagtag

DBGET integrated database retrieval system