KEGG   Homo sapiens (human): 6916Help
Entry
6916              CDS       T01001                                 

Gene name
TBXAS1, BDPLT14, CYP5, CYP5A1, GHOSAL, THAS, TS, TXAS, TXS
Definition
thromboxane A synthase 1 (platelet) (EC:5.3.99.5)
Orthology
K01832  
thromboxane-A synthase [EC:5.3.99.5]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Disease
H00490  
Diaphyseal dysplasia with anemia (Ghosal)
Drug target
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q34-q35
AA seq 534 aa AA seqDB search
MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFF
RQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKS
VADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQ
RCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPL
ARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDI
VRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLAT
NPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCE
VLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSC
LGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagccttggggtttctaaaattggaagtgaatggccccatggtgacggtggcc
ctgtcagtggctctcttggccctcctgaaatggtactccacatcagcattctcaagactg
gagaagttaggcctcagacatcccaagccttctcctttcattggaaacttgacatttttc
cgccagggtttttgggaaagccaaatggagctcagaaagctgtatggacctctgtgtggg
tactatcttggtcgtcggatgtttattgttatttctgagccagacatgatcaagcaggtg
ttggttgagaacttcagtaactttaccaacagaatggcgtcgggtttggagttcaagtcg
gtagccgacagcgttctgtttttacgtgacaaaagatgggaagaggtcagaggtgccctg
atgtctgctttcagtcctgaaaagctgaacgagatggttcccctcatcagccaagcctgc
gaccttctcctggctcatttaaaacgctatgcggaatctggggacgcatttgacatccag
aggtgctactgcaattacaccacagatgtggttgccagcgtcgcctttggcaccccggtg
gactcctggcaggcccctgaggatccctttgtgaaacactgcaagcgtttcttcgaattc
tgcatccccagacctatcctggttttactcttatcatttccatccataatggtcccactg
gcccggattttgcccaataagaaccgagacgaactgaatggcttttttaacaaactcatt
aggaatgtgattgccttgcgggaccagcaagctgccgaagagaggcggagagacttcctc
caaatggtcctggatgcccgacattctgcaagtcccatgggcgtgcaagactttgacatc
gtcagagacgttttctcctctactgggtgcaagccgaacccttcccggcaacaccagccc
agccctatggccaggcctttgactgtggatgagattgtgggccaggccttcatcttcctc
atcgctggctatgaaatcatcaccaacacactttcttttgccacctacctactggccacc
aaccctgactgccaagagaagcttctgagagaggtagacgtttttaaggagaaacacatg
gcccctgagttctgcagcctcgaggaaggcctgccctatctggacatggtgattgcagag
acgctgaggatgtacccgccagctttcagattcacacgggaggcagctcaggactgcgag
gtgctggggcagcgcatccccgcaggcgctgtgctagagatggccgtgggtgccctgcac
catgaccctgagcactggccaagcccggagaccttcaaccctgaaaggttcacggctgag
gcccggcagcagcaccggcccttcacgtacctgcccttcggggccggcccacggagctgc
ctcggggtgcgtctagggctgcttgaggtcaagttgacactgctccacgtgctgcacaag
ttccggttccaagcctgccctgagacccaggtaccgctgcagctagaatccaaatctgcc
ctaggtccaaaaaatggtgtctatatcaagatcgtatcccgctga

DBGET integrated database retrieval system