KEGG   Homo sapiens (human): 6928Help
Entry
6928              CDS       T01001                                 

Gene name
HNF1B, FJHN, HNF-1-beta, HNF-1B, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF-2, TCF2, VHNF1
Definition
(RefSeq) HNF1 homeobox B
  KO
K08034  
transcription factor 2, hepatocyte nuclear factor 1-beta
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Disease
H00409  
Type II diabetes mellitus
H00410  
Maturity onset diabetes of the young (MODY)
H00541  
Autosomal dominant tubulointerstitial kidney disease (ADTKD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    6928 (HNF1B)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, HNF1
    6928 (HNF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P35680(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 557 aa AA seqDB search
MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKP
VFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWR
AAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREIL
RQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGP
ASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWF
ANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPSSSPPNKLSGVRYSQQGNNEI
TSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMISVSGGGLPPVSTLTNIH
SLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHS
PHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSI
STLTNMSSSKQCPLQAW
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccaagctcacgtcgctccagcaagaactcctgagcgccctgctgagctccggg
gtcaccaaggaggtgctggttcaggccttggaggagttgctgccatccccgaacttcggg
gtgaagctggagacgctgcccctgtcccctggcagcggggccgagcccgacaccaagccg
gtcttccatactctcaccaacggccacgccaagggccgcttgtccggcgacgagggctcc
gaggacggcgacgactatgacacacctcccatcctcaaggagctgcaggcgctcaacacc
gaggaggcggcggagcagcgggcggaggtggaccggatgctcagtgaggacccttggagg
gctgctaaaatgatcaagggttacatgcagcaacacaacatcccccagagggaggtggtc
gatgtcaccggcctgaaccagtcgcacctctcccagcatctcaacaagggcacccctatg
aagacccagaagcgtgccgctctgtacacctggtacgtcagaaagcaacgagagatcctc
cgacaattcaaccagacagtccagagttctggaaatatgacagacaaaagcagtcaggat
cagctgctgtttctctttccagagttcagtcaacagagccatgggcctgggcagtccgat
gatgcctgctctgagcccaccaacaagaagatgcgccgcaaccggttcaaatgggggccc
gcgtcccagcaaatcttgtaccaggcctacgatcggcaaaagaaccccagcaaggaagag
agagaggccttagtggaggaatgcaacagggcagaatgtttgcagcgaggggtgtccccc
tccaaagcccacggcctgggctccaacttggtcactgaggtccgtgtctacaactggttt
gcaaaccgcaggaaggaggaggcattccggcaaaagctggccatggacgcctatagctcc
aaccagactcacagcctgaaccctctgctctcccacggctccccccaccaccagcccagc
tcctctcctccaaacaagctgtcaggagtgcgctacagccagcagggaaacaatgagatc
acttcctcctcaacaatcagtcaccatggcaacagcgccatggtgaccagccagtcggtt
ttacagcaagtctccccagccagcctggacccaggccacaatctcctctcacctgatggt
aaaatgatctcagtctcaggaggaggtttgcccccagtcagcaccttgacgaatatccac
agcctctcccaccataatccccagcaatctcaaaacctcatcatgacacccctctctgga
gtcatggcaattgcacaaagcctcaacacctcccaagcacagagtgtccctgtcatcaac
agtgtggccggcagcctggcagccctgcagcccgtccagttctcccagcagctgcacagc
cctcaccagcagcccctcatgcagcagagcccaggcagccacatggcccagcagcccttc
atggcagctgtgactcagctgcagaactcacacatgtacgcacacaagcaggaacccccc
cagtattcccacacctcccggtttccatctgcaatggtggtcacagataccagcagcatc
agtacactcaccaacatgtcttcaagtaaacagtgtcctctacaagcctggtga

DBGET integrated database retrieval system