KEGG   Homo sapiens (human): 6932Help
Entry
6932              CDS       T01001                                 

Gene name
TCF7, TCF-1
Definition
transcription factor 7 (T-cell specific, HMG-box)
Orthology
K02620  
transcription factor 7
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Adherens junction
Melanogenesis
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Thyroid cancer
Basal cell carcinoma
Acute myeloid leukemia
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    6932 (TCF7)
   04390 Hippo signaling pathway
    6932 (TCF7)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    6932 (TCF7)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    6932 (TCF7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6932 (TCF7)
   05210 Colorectal cancer
    6932 (TCF7)
   05216 Thyroid cancer
    6932 (TCF7)
   05221 Acute myeloid leukemia
    6932 (TCF7)
   05217 Basal cell carcinoma
    6932 (TCF7)
   05215 Prostate cancer
    6932 (TCF7)
   05213 Endometrial cancer
    6932 (TCF7)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    6932 (TCF7)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    6932 (TCF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 269 aa AA seqDB search
MYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAP
ADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPA
IVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKE
SAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQE
STTETNWPRELKDGNGQESLSMSSSSSPA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagagaccgtctactccgccttcaatctgctcatgcattacccacccccctcg
ggagcagggcagcacccccagccgcagcccccgctgcacaaggccaatcagcccccccac
ggtgtcccccaactctctctctacgaacatttcaacagcccacatcccacccctgcacct
gcggacatcagccagaagcaagttcacaggcctctgcagacccctgacctctctggcttc
tactccctgacctcaggcagcatggggcagctcccccacactgtgagctggttcacccac
ccatccttgatgctaggttctggtgtacctggtcacccagcagccatcccccacccggcc
attgtgcccccctcagggaagcaggagctgcagcccttcgaccgcaacctgaagacacaa
gcagagtccaaggcagagaaggaggccaagaagccaaccatcaagaagcccctcaatgcc
ttcatgctgtacatgaaggagatgagagccaaggtcattgcagagtgcacacttaaggag
agcgctgccatcaaccagatcctgggccgcaggtggcacgcgctgtcgcgagaagagcag
gccaagtactatgagctggcccgcaaggagaggcagctgcacatgcagctatacccaggc
tggtcagcgcgggacaactacgggaagaagaagaggcggtcgagggaaaagcaccaagaa
tccaccacagagacaaactggcccagagaactcaaggatggtaatggacaagagtcactg
tccatgtcttcttcctctagcccagcttga

DBGET integrated database retrieval system