KEGG   Homo sapiens (human): 6935Help
Entry
6935              CDS       T01001                                 

Gene name
ZEB1, AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
Definition
(RefSeq) zinc finger E-box binding homeobox 1
  KO
K09299  
zinc finger homeobox protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
MicroRNAs in cancer
Disease
H00960  
Fuchs corneal dystrophy (FECD)
H00961  
Posterior polymorphous corneal dystrophy (PPCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    6935 (ZEB1)
   05206 MicroRNAs in cancer
    6935 (ZEB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    6935 (ZEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p11.2
AA seq 1124 aa AA seqDB search
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaattcagattcagatgatgaagacaaactgcat
attgtggaagaagaaagtgttacagatgcagctgactgtgaaggtgtaccagaggatgac
ctgccaacagaccagacagtgttaccagggaggagcagtgaaagagaagggaatgctaag
aactgctgggaggatgacagaaaggaagggcaagaaatcctggggcctgaagctcaggca
gatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgcagaaaatgagcaa
aaccatgatcctaatgttgaagagtttctacaacaacaagacactgctgtcatttttcct
gaggcacctgaagaggaccagaggcagggcacaccagaagccagtggtcatgatgaaaat
ggaacaccagatgcattttcacaattactcacctgtccatattgtgatagaggctataaa
cgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaatgaagataacttt
agttgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatgaca
tcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgtaatcgtaaattc
aaatgcactgagtgtggaaaagctttcaaatacaaacatcacctaaaagagcacttaaga
attcacagtggagagaagccatatgaatgcccaaactgcaagaaacgcttttcccattct
ggctcctatagctcacacataagcagtaagaaatgtatcagcttgatacctgtgaatggg
cgaccaagaacaggactcaagacatctcagtgttcttcaccgtctctttcagcatcacca
ggcagtcccacacgaccacagatacggcaaaagatagagaataaaccccttcaagaacaa
ctttctgttaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtggtt
gcttcaggaatcaactgttcaacccctttacaaaatggggttttcactggtggtggccca
ttacaggcaaccagttctcctcagggcatggtgcaagctgttgttctgccaacagttggt
ttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggcggta
gatggtaatgtaataaggcaagtgttggagaataatcaagccaatcttgcatccaaagaa
caagaaacaatcaatgcttcacccatacaacaaggtggccattctgttatttcagccatc
agtcttcctttggttgatcaagatggaacaaccaaaattatcatcaactacagtcttgag
cagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaatccagtcgctaca
aacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtctgagaaggacaaa
agctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgattgtccaggagat
attaatgcacttccagaattaaagcactatgacctaaagcagcctactcagcctcctcca
ctccctgcagcagaagctgagaagcctgagtcctctgtttcatcagctactggagatggc
aatttgtctcctagtcagccacctttaaagaacctcttgtctctcctaaaagcatattat
gctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgattcagtaaaccta
ccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttcagtgcag
tcttctgaaccatcttctcctgaaccaggcaaagtaaatatccctgccaagaacaatgat
cagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaatctacaaagtcct
ttgaagatgactaactccccagttttaccagtgggatcaaccaccaatggttccagaagt
agtacaccatccccatcacctctaaacctttcctcatccagaaatacacagggttacttg
tacacagctgagggtgcacaagaagagccacaagtagaacctcttgatctttcactacca
aagcaacagggagaattattagaaaggtcaactatcactagtgtttaccagaacagtgtt
tattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggagccacaaaaggac
agttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaaccccata
aatatcgctatacctacagtcactgcccagttacccacaatcgtggccattgctgaccag
aacagtgttccatgcttaagagcgctagctgccaataagcaaacgattctgattccccag
gtggcatacacctactcaactacggtcagccctgcagtccaagaaccacccttgaaagtg
atccagccaaatggaaatcaggatgaaagacaagatactagctcagaaggagtatcaaat
gtagaggatcagaatgactctgattctacaccgcccaaaaagaaaatgcggaagacagaa
aatggaatgtatgcttgtgatttgtgtgacaagatattccaaaagagtagttcattattg
agacataaatatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaaaaggca
tttaaacacaaacatcatttgattgaacacatgcgattacattctggagaaaagccctat
caatgtgacaaatgtggaaagcgcttctcacactctgggtcttattctcaacacatgaat
catcgctactcctactgtaagagagaagcggaagaacgtgacagcacagagcaggaagag
gcagggcctgaaatcctctcgaatgagcacgtgggtgccagggcgtctccctcacagggc
gactcggacgagagagagagtttgacaagggaagaggatgaagacagtgaaaaagaggaa
gaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgtgaaaaaccacaa
ggggatgaggaagaggaggaggaggaggaagaagtggaagaagaagaggtagaagaggca
gagaatgagggagaagaagcaaaaactgaaggtctgatgaaggatgacagggctgaaagt
caagcaagcagcttaggacaaaaagtaggcgagagtagtgagcaagtgtctgaagaaaag
acaaatgaagcctaa

DBGET integrated database retrieval system