KEGG   Homo sapiens (human): 694Help
Entry
694               CDS       T01001                                 

Gene name
BTG1, APRO2
Definition
(RefSeq) BTG anti-proliferation factor 1
  KO
K14443  
protein Tob/BTG
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    694 (BTG1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     694 (BTG1)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     694 (BTG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P62324(Tbio)
UniProt: 
Position
12q21.33
AA seq 171 aa AA seqDB search
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEK
PCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGS
ICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccttctacacccgggccgccaccatgataggcgagatcgccgccgccgtgtcc
ttcatctccaagtttctccgcaccaaggggctcacgagcgagcgacagctgcagaccttc
agccagagcctgcaggagctgctggcagaacattataaacatcactggttcccagaaaag
ccatgcaagggatcgggttaccgttgtattcgcatcaaccataaaatggatcctctgatt
ggacaggcagcacagcggattggactgagcagtcaggagctgttcaggcttctcccaagt
gaactcacactctgggttgacccctatgaagtgtcctacagaattggagaggatggctcc
atctgtgtgctgtatgaagcctcaccagcaggaggtagcactcaaaacagcaccaacgtg
caaatggtagacagccgaatcagctgtaaggaggaacttctcttgggcagaacgagccct
tccaaaaactacaatatgatgactgtatcaggttaa

DBGET integrated database retrieval system