KEGG   Homo sapiens (human): 6944Help
Entry
6944              CDS       T01001                                 

Gene name
VPS72, CFL1, Swc2, TCFL1, YL-1, YL1
Definition
(RefSeq) vacuolar protein sorting 72 homolog
  KO
K11664  
vacuolar protein sorting-associated protein 72
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   SRCAP complex
    6944 (VPS72)
   SWR1 complex
    6944 (VPS72)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 364 aa AA seqDB search
MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSD
FDIDEGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPL
ELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITE
ELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPA
PSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPAL
YRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLPGSGPRALRQK
IVIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtttggctgggggccgggcaccccggaagaccgctgggaaccggctttctgggctt
ttggaggcagaggaggaagatgagttctaccagacgacttatgggggtttcacagaggaa
tccggagatgatgagtatcaaggggaccagtcagacacagaggacgaagtggactctgac
tttgacattgatgaaggggatgaaccatccagtgatggagaagcagaagagccaagaagg
aagcgccgagtagtcaccaaggcctataaggaacctctcaagagcttaaggcctcgaaag
gtcaacaccccggctggtagctctcagaaggcgcgagaagagaaggcactactgccatta
gaactacaagatgacggctctgacagtcggaagtctatgcgtcagtctacagctgagcat
acacgacaaacgttccttcgggtacaggagaggcagggccagtcaagacggcgaaagggg
ccccactgtgagcggccactaacccaggaggaactgctccgggaggccaagatcacagaa
gagcttaatttacggtcactggagacatatgagcggctcgaggctgataaaaagaagcag
gttcataagaagcggaagtgccccgggcccataatcacctatcattcagtgacagtgcca
cttgttggggagccaggccccaaggaagagaacgttgacatagaaggacttgatcctgct
ccctcggtgtctgcattgactcctcatgctgggactggacccgtcaacccccctgctcgc
tgctcacgtaccttcatcacttttagtgatgatgcaactttcgaggaatggttcccccaa
gggcggcccccaaaagtccctgttcgtgaggtctgtccagtgacccatcgtccagcccta
taccgggaccctgttacagacataccctatgccactgctcgagccttcaagatcattcgt
gaggcttacaagaagtacattactgcccatggactgccgcccactgcctcagccctgggc
cccggcccgccacctcctgagcccctccctggctctgggccccgagccttgcgccagaaa
attgtcattaaatga

DBGET integrated database retrieval system