KEGG   Homo sapiens (human): 699Help
Entry
699               CDS       T01001                                 

Gene name
BUB1, BUB1A, BUB1L, hBUB1
Definition
BUB1 mitotic checkpoint serine/threonine kinase (EC:2.7.11.1)
Orthology
K02178  
checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    699 (BUB1)
   04114 Oocyte meiosis
    699 (BUB1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    699 (BUB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     699 (BUB1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  BUB family
   699 (BUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14
AA seq 1065 aa AA seqDB search
MDTPENVLQYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNS
DLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQY
RLFQTRLTETHLPAQARTSEPLHNVQVLNQMITSKSNPGNNMACISKNQGSELSGVISSA
CDKESNMERRVITISKSEYSVHSSLASKVDVEQVVMYCKEKLIRGESEFSFEELRAQKYN
QRRKHEQWVNEDRHYMKRKEANAFEEQLLKQKMDELHKKLHQVVETSHEDLPASQERSEV
NPARMGPSVGSQQELRAPCLPVTYQQTPVNMEKNPREAPPVVPPLANAISAALVSPATSQ
SIAPPVPLKAQTVTDSMFAVASKDAGCVNKSTHEFKPQSGAEIKEGCETHKVANTSSFHT
TPNTSLGMVQATPSKVQPSPTVHTKEALGFIMNMFQAPTLPDISDDKDEWQSLDQNEDAF
EAQFQKNVRSSGAWGVNKIISSLSSAFHVFEDGNKENYGLPQPKNKPTGARTFGERSVSR
LPSKPKEEVPHAEEFLDDSTVWGIRCNKTLAPSPKSPGDFTSAAQLASTPFHKLPVESVH
ILEDKENVVAKQCTQATLDSCEENMVVPSRDGKFSPIQEKSPKQALSSHMYSASLLRLSQ
PAAGGVLTCEAELGVEACRLTDTDAAIAEDPPDAIAGLQAEWMQMSSLGTVDAPNFIVGN
PWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQ
VYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQN
GSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKP
DNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNK
PWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPD
CHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggacaccccggaaaatgtccttcaatacatacagtgggtagaagagaattttcctgag
aataaagaatacttgataactttactagaacatttaatgaaggaatttttagataagaag
aaataccacaatgacccaagattcatcagttattgtttaaaatttgctgagtacaacagt
gacctccatcaattttttgagtttctgtacaaccatgggattggaaccctgtcatcccct
ctgtacattgcctgggcggggcatctggaagcccaaggagagctgcagcatgccagtgct
gtccttcagagaggaattcaaaaccaggctgaacccagagagttcctgcaacaacaatac
aggttatttcagacacgcctcactgaaacccatttgccagctcaagctagaacctcagaa
cctctgcataatgttcaggttttaaatcaaatgataacatcaaaatcaaatccaggaaat
aacatggcctgcatttctaagaatcagggttcagagctttctggagtgatatcttcagct
tgtgataaagagtcaaatatggaacgaagagtgatcacgatttctaaatcagaatattct
gtgcactcatctttggcatccaaagttgatgttgagcaggttgttatgtattgcaaggag
aagcttattcgtggggaatcagaattttcctttgaagaattgagagcccagaaatacaat
caacggagaaagcatgagcaatgggtaaatgaagacagacattatatgaaaaggaaagaa
gcaaatgcttttgaagaacagctattaaaacagaaaatggatgaacttcataagaagttg
catcaggtggtggagacatcccatgaggatctgcccgcttcccaggaaaggtccgaggtt
aatccagcacgtatggggccaagtgtaggctcccagcaggaactgagagcgccatgtctt
ccagtaacctatcagcagacaccagtgaacatggaaaagaacccaagagaggcacctcct
gttgttcctcctttggcaaatgctatttctgcagctttggtgtccccagccaccagccag
agcattgctcctcctgttcctttgaaagcccagacagtaacagactccatgtttgcagtg
gccagcaaagatgctggatgtgtgaataagagtactcatgaattcaagccacagagtgga
gcagagatcaaagaagggtgtgaaacacataaggttgccaacacaagttcttttcacaca
actccaaacacatcactgggaatggttcaggcaacgccatccaaagtgcagccatcaccc
accgtgcacacaaaagaagcattaggtttcatcatgaatatgtttcaggctcctacactt
cctgatatttctgatgacaaagatgaatggcaatctctagatcaaaatgaagatgcattt
gaagcccagtttcaaaaaaatgtaaggtcatctggggcttggggagtcaataagatcatc
tcttctttgtcatctgcttttcatgtgtttgaagatggaaacaaagaaaattatggatta
ccacagcctaaaaataaacccacaggagccaggacctttggagaacgctctgtcagcaga
cttccttcaaaaccaaaggaggaagtgcctcatgctgaagagtttttggatgactcaact
gtatggggtattcgctgcaacaaaaccctggcacccagtcctaagagcccaggagacttc
acatctgctgcacaacttgcgtctacaccattccacaagcttccagtggagtcagtgcac
attttagaagataaagaaaatgtggtagcaaaacagtgtacccaggcgactttggattct
tgtgaggaaaacatggtggtgccttcaagggatggaaaattcagtccaattcaagagaaa
agcccaaaacaggccttgtcgtctcacatgtattcagcatccttacttcgtctgagccag
cctgctgcaggtggggtacttacctgtgaggcagagttgggcgttgaggcttgcagactc
acagacactgacgctgccattgcagaagatccaccagatgctattgctgggctccaagca
gaatggatgcagatgagttcacttgggactgttgatgctccaaacttcattgttgggaac
ccatgggatgataagctgattttcaaacttttatctgggctttctaaaccagtgagttcc
tatccaaatacttttgaatggcaatgtaaacttccagccatcaagcccaagactgaattt
caattgggttctaagctggtctatgtccatcaccttcttggagaaggagcctttgcccag
gtgtacgaagctacccagggagatctgaatgatgctaaaaataaacagaaatttgtttta
aaggtccaaaagcctgccaacccctgggaattctacattgggacccagttgatggaaaga
ctaaagccatctatgcagcacatgtttatgaagttctattctgcccacttattccagaat
ggcagtgtattagtaggagagctctacagctatggaacattattaaatgccattaacctc
tataaaaatacccctgaaaaagtgatgcctcaaggtcttgtcatctcttttgctatgaga
atgctttacatgattgagcaagtgcatgactgtgaaatcattcatggagacattaaacca
gacaatttcatacttggaaacggatttttggaacaggatgatgaagatgatttatctgct
ggcttggcactgattgacctgggtcagagtatagatatgaaactttttccaaaaggaact
atattcacagcaaagtgtgaaacatctggttttcagtgtgttgagatgctcagcaacaaa
ccatggaactaccagatcgattactttggggttgctgcaacagtatattgcatgctcttt
ggcacttacatgaaagtgaaaaatgaaggaggagagtgtaagcctgaaggtctttttaga
aggcttcctcatttggatatgtggaatgaattttttcatgttatgttgaatattccagat
tgtcatcatcttccatctttggatttgttaaggcaaaagctgaagaaagtatttcaacaa
cactatactaacaagattagggccctacgtaataggctaattgtactgctcttagaatgt
aagcgttcacgaaaataa

DBGET integrated database retrieval system