KEGG   Homo sapiens (human): 7001Help
Entry
7001              CDS       T01001                                 

Gene name
PRDX2, HEL-S-2a, NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA
Definition
(RefSeq) peroxiredoxin 2 (EC:1.11.1.15)
  KO
K03386  
peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     7001 (PRDX2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7001 (PRDX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 198 aa AA seqDB search
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtaacgcgcgcatcggaaagccagcccctgacttcaaggccacagcggtg
gttgatggcgccttcaaagaggtgaagctgtcggactacaaagggaagtacgtggtcctc
tttttctaccctctggacttcacttttgtgtgccccaccgagatcatcgcgttcagcaac
cgtgcagaggacttccgcaagctgggctgtgaagtgctgggcgtctcggtggactctcag
ttcacccacctggcttggatcaacaccccccggaaagagggaggcttgggccccctgaac
atccccctgcttgctgacgtgaccagacgcttgtctgaggattacggcgtgctgaaaaca
gatgagggcattgcctacaggggcctctttatcatcgatggcaagggtgtccttcgccag
atcactgttaatgatttgcctgtgggacgctccgtggatgaggctctgcggctggtccag
gccttccagtacacagacgagcatggggaagtttgtcccgctggctggaagcctggcagt
gacacgattaagcccaacgtggatgacagcaaggaatatttctccaaacacaattag

DBGET integrated database retrieval system