KEGG   Homo sapiens (human): 7006Help
Entry
7006              CDS       T01001                                 

Gene name
TEC, PSCTK4
Definition
(RefSeq) tec protein tyrosine kinase (EC:2.7.10.2)
  KO
K07364  
tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    7006 (TEC)
  Development
   04380 Osteoclast differentiation
    7006 (TEC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7006 (TEC)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Tec family [OT]
   7006 (TEC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p12
AA seq 631 aa AA seqDB search
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIK
CVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKY
HPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNS
EEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSN
NLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVECEETFGR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaacactattttggaggagattcttattaaaaggtcacagcagaaaaagaag
acatcgcccttaaactacaaagagagactttttgtacttacaaagtccatgctaacctac
tatgagggtcgagcagagaagaaatacagaaaggggtttattgatgtttcaaaaatcaag
tgtgtggaaatagtgaagaatgatgatggtgtcattccctgtcaaaataagtatccattt
caggttgttcatgatgctaacacactttacatttttgcacctagtccacaaagcagggac
ctgtgggtgaagaagttaaaagaagaaataaagaacaacaataatattatgattaaatat
catcctaaattctggacagatggaagttatcagtgttgtagacaaactgaaaaattagca
cccggatgtgaaaaatacaatctttttgagagcagtataagaaaagcactacctccagca
ccagaaacaaagaagcgaaggcctcccccaccaattccactagaagaagaagataatagt
gaagaaatcgttgtagccatgtatgatttccaagcagcagaaggacatgatctcagatta
gagagaggccaagagtatctcattttagaaaagaatgatgttcattggtggagagcaaga
gataaatatgggaatgaaggatatatcccaagtaattacgtaacgggaaagaaatcaaac
aacttagatcaatatgaatggtattgcagaaatatgaatagaagcaaggcagagcaactc
ctccgcagtgaagataaagaaggtggttttatggtaagggattccagtcaaccaggcttg
tacacagtctccctttataccaagtttggaggagaaggttcatcgggttttaggcattat
catataaaggaaacaacaacatctccaaagaagtattacctagctgaaaaacatgctttt
ggctccattcctgagattattgaatatcataagcacaatgcagcaggacttgtcaccagg
cttcggtacccagttagtgtgaaagggaagaatgcacccaccactgcaggattcagctat
gagaaatgggagattaacccttcagaactgacctttatgagggaattgggaagtggactg
tttggagtggtgaggcttggcaaatggcgagcccagtacaaagtcgcaatcaaagctatt
cgggaaggtgcaatgtgcgaggaggactttatagaagaagctaaagtgatgatgaaactg
acacacccgaagttagtgcagctttatggtgtgtgcacccagcagaaaccaatatacatt
gttactgagttcatggaaaggggctgccttctgaatttcctccgacagagacaaggtcat
ttcagtagagacgtactgctgagcatgtgtcaggatgtgtgtgaagggatggagtatctg
gagagaaacagcttcatccacagagatctggctgccagaaattgtctagtaagtgaggcg
ggagttgtaaaagtatctgattttggaatggccaggtatgttctggatgatcagtacaca
agttcttctggtgctaagtttcctgtgaagtggtgtccacctgaagtgtttaattacagc
cgcttcagcagcaaatcagatgtctggtcatttggtgttttaatgtgggaagtattcacg
gaaggcagaatgccttttgaaaaatacaccaattatgaagtggtaaccatggttactcga
ggccaccgactctaccagccgaagttggcgtccaactatgtgtatgaggtgatgctgaga
tgttggcaggagaaaccagagggaaggccttctttcgaagatctgctgcgcacaatagat
gaactagttgaatgtgaagaaacttttggaagataa

DBGET integrated database retrieval system